KEGG   Felis catus (domestic cat): 101097022Help
Entry
101097022         CDS       T02385                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fca  Felis catus (domestic cat)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101097022 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    101097022 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101097022 (COMT)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     101097022 (COMT)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101097022 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D3
AA seq 324 aa AA seqDB search
MLEAPPLLLAAFSLGLVLLVLLLCHSYSGFLLICWNEFVLQPLYNLFMGDTKEQRILRHV
LQHAVAGDPQSVLEAIDTYCLQKEWAMNVGDKKGQILDAVVREQRPSVLLELGAYCGYSA
VRMARLLEPGARLLTIELNPDYAAITQQMLDFAGLQDRVTVVAGPSQDIIPQLKKKYDVD
MLDMVFLDHWKDRYLPDTLLLEAPYCASPCTPISPSSYLIPYQPLTLLLGQPQSGDQGGC
LIPRSVACYGRGQCCWPTTLSAQEHQNSWHMCATAAALSAHTSPRTWSTRQQWMASRRLS
TWAWMAQHSLDHPPCSRLPCQAWL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccacccctgctgttggcagccttctcattgggcctggtactgctggtg
ctgctgctgtgccactcctactcgggctttctccttatctgctggaatgagttcgtcctg
cagcccctctacaacctgttcatgggcgacaccaaggagcagcgcatcctgcgtcatgtg
ctgcagcatgcggtggccggggacccacaaagtgtgctggaggccatcgatacctactgt
ttacagaaggagtgggctatgaatgtgggtgacaagaaaggccagatcttggatgcagtg
gtgcgggagcagcgcccatcggtgctgctagagctgggggcctactgcggctactcagcc
gtgcgcatggcccgcctgctggagcccggggcccgactgctcaccattgagctcaaccct
gactacgccgccatcacccagcagatgctggactttgcaggcctgcaggacagggtaacc
gttgtggccgggccatcccaggacatcatcccccagctgaagaagaaatacgatgtggac
atgctagacatggtcttccttgaccactggaaggaccggtacctgccagacactcttctc
ctggaggctccttattgtgcatccccctgcacccctatctcaccatcctcatacctcatc
ccataccagcccttaacgctgctgcttggccagccccaaagtggtgaccagggaggctgc
ctcatccccaggagtgtggcctgctacggaaggggacagtgttgctggccgacaacgtta
tctgcccaggaacaccagaattcctggcatatgtgcgcaacagcagccgctttgagtgca
cacacttcacctcgtacctggagtactcgacagcagtggatggcctcgagaaggctgtct
acatgggcctggatggcccagcacagccttgaccacccaccctgctccaggctcccttgc
caagcctggttatga

DBGET integrated database retrieval system