KEGG   Felis catus (domestic cat): 101097022Help
Entry
101097022         CDS       T02385                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
fca  Felis catus (domestic cat)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:fca00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:fca00350]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:fca04728]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D3
AA seq 221 aa AA seqDB search
MGDTKEQRILRHVLQHAVAGDPQSVLEAIDTYCLQKEWAMNVGDKKGQILDAVVREQRPS
VLLELGAYCGYSAVRMARLLEPGARLLTIELNPDYAAITQQMLDFAGLQDRVTVVAGPSQ
DIIPQLKKKYDVDMLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGTPEFL
AYVRNSSRFECTHFTSYLEYSTAVDGLEKAVYMGLDGPAQP
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaccaaggagcagcgcatcctgcgtcatgtgctgcagcatgcggtggccggg
gacccacaaagtgtgctggaggccatcgatacctactgtttacagaaggagtgggctatg
aatgtgggtgacaagaaaggccagatcttggatgcagtggtgcgggagcagcgcccatcg
gtgctgctagagctgggggcctactgcggctactcagccgtgcgcatggcccgcctgctg
gagcccggggcccgactgctcaccattgagctcaaccctgactacgccgccatcacccag
cagatgctggactttgcaggcctgcaggacagggtaaccgttgtggccgggccatcccag
gacatcatcccccagctgaagaagaaatacgatgtggacatgctagacatggtcttcctt
gaccactggaaggaccggtacctgccagacactcttctcctggaggagtgtggcctgcta
cggaaggggacagtgttgctggccgacaacgttatctgcccaggaacaccagaattcctg
gcatatgtgcgcaacagcagccgctttgagtgcacacacttcacctcgtacctggagtac
tcgacagcagtggatggcctcgagaaggctgtctacatgggcctggatggcccagcacag
ccttga

DBGET integrated database retrieval system