KEGG   Felis catus (domestic cat): 101097032Help
Entry
101097032         CDS       T02385                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     101097032 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E2
AA seq 573 aa AA seqDB search
MGTVVRIGPRVLGWVACLLLAFPATATGPEVTQPEVDTTLGRVRGQQVGVKGTDRLVNAF
LGIPFAKPPLGPGQFSAPRPVQSWEGVRDASTAPAMCLQDLERMDNSRFVLNGKHQHFPI
SEDCLILNIYSPAEATVVARRTVMVWIHGGALVAGTATSQDESALAAYGDVVVVTVQYRL
GLLGFLSTGDEHAPGNWGFLDVVATLHWVQGNISPLGGDPNSVTIFGGSASACIVSALVL
SPLAAGLFHRAIAQSGVITIPGLQASNPRLLAQSFADSMACSSTSSAEMLQCLREKANKE
QILNMKLNTTATYTIDGTFFPKSPRELLRERQFHSVPFLLGVNNHEFGWLIPKGXGFLGK
MGKMSLEDMLAILRPHLTILDIPPEVMPTIIDEYLGGSFDAEARRNAIQEFWADLIVIFP
TLNFSRNLXDSGAPVFFYEFQHRPSSFAKIKPDWVRADHGAEIAFIFGGPFLMDENSLLA
FPEATQEEKQLSLTMMAQWTQFARTGXAALDFIHFSYPGTPFKQLEQYLEISPTPRVGQK
LREAQMQFWAEILSANFRQWQQKQKGRKAQEEL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggggacagtggtaagaatcgggcccagggtcctgggctgggtggcctgtctgctcctg
gcattccctgctacagccaccgggcctgaggtcactcagcctgaagtggacaccaccctg
ggccgtgtgcgaggccagcaagtgggcgtgaagggcacagaccgccttgtgaatgccttc
ctgggcatcccgtttgccaagccacctctggggcctggtcaattctcagccccgcgccca
gtgcagtcctgggaaggtgtgcgggatgccagcactgcccctgcaatgtgcctgcaggat
ctggagagaatggacaacagcagatttgtgttgaacggaaagcaccagcacttccctatt
tcagaggactgtctgatcctcaacatctacagcccggctgaggccaccgtggtggccagg
cggacggtcatggtatggatccatgggggcgctctggtggccggcaccgccacctcccag
gacgagtcagccctggccgcctatggggatgtggtagtggtcacggtccagtaccgcctg
gggctccttggcttcctcagcactggagacgagcacgcccctggcaactggggcttccta
gatgtggtggctactctgcactgggtgcaggggaacatctcccccttgggaggtgacccc
aactctgtcaccatctttggcggttctgccagtgcctgcatcgtctctgccctggtcctg
tccccgctggctgcagggctattccacagagccatagcccagagtggagtcatcaccatt
cccggcttacaggcttcgaacccaaggctcctggctcaaagcttcgcggactccatggcc
tgcagctctacctcctcagctgagatgttgcagtgccttcgggagaaggcaaacaaggag
cagatccttaacatgaagttgaacactacagctacctacaccattgatggcaccttcttt
cccaagagccccagggagctcttgagggagaggcagttccattctgtgcccttcctcctg
ggtgtcaacaatcacgagtttggctggcttatccccaagggctgaggtttcctgggtaag
atggggaagatgagcctggaggatatgctggccatattaagaccccacttgaccattctg
gatataccccctgaggtgatgcccaccatcatagatgaatacctaggcggcagtttcgac
gcagaagccagacgtaatgccatccaggaattttgggctgaccttatcgttatctttccc
accttgaatttctcaagaaacctctgagattctggagctcccgtctttttctatgagttc
cagcatcgacccagttcttttgcgaagatcaaaccagactgggtgagggctgaccatggg
gctgagattgccttcatattcgggggtcctttcctcatggatgagaactccctgctggcc
tttccagaagctacacaggaggagaagcagctgagcctcaccatgatggcccagtggacc
caatttgcccggacagggtgagcggccctggacttcattcatttttcctacccagggacc
ccattcaagcagttggagcaatacctggagatcagcccgacaccacgagttggccagaag
ctaagagaagcccaaatgcagttctgggcagagatactttctgccaacttccggcagtgg
cagcagaagcagaagggcaggaaggcccaggaggagctctga

DBGET integrated database retrieval system