KEGG   Felis catus (domestic cat): 101097167Help
Entry
101097167         CDS       T02385                                 

Gene name
KCNMB3
Definition
(RefSeq) potassium channel subfamily M regulatory beta subunit 3
  KO
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
fca  Felis catus (domestic cat)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    101097167 (KCNMB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    101097167 (KCNMB3)
  Circulatory system
   04270 Vascular smooth muscle contraction
    101097167 (KCNMB3)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   101097167 (KCNMB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C2
AA seq 283 aa AA seqDB search
MQPFSIPVQITLQGGRRRQGRTAFSASGRNRNIDHDDGDLPDVHKKLPSSAGEDRALLLG
FAMMGFSVLMFFLFGITILKPFMLSIQREESNCTTIHTHITDDWMDCAFPCGVGCRGRGE
YPCLQVFVNVTHSGQKALLHYNEEAVQINSKCFYTPKCHRDRNDLLNSVLDIKEFFDHKN
GTPFSCFYSPDSQSEDVILIKKYNQMVIFHCLFWPSLTLLGGALIVGMVRLTQYLSLLCE
KYSVALRDEVGGKVPYMEQHRFKLWSVGRDKERGRKILRQWPD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgttcagcatccccgttcagattacactccagggtggccggaggcgccagggg
aggacagccttttctgcctcaggcagaaatagaaatatagaccacgatgatggagactta
ccagatgtgcacaagaagctgccatccagtgctggagaggaccgagccttgctgctgggc
tttgcaatgatgggcttctcagtcctcatgttcttcttgtttggaattaccatcctaaag
cctttcatgctcagcattcagagagaagagtcgaactgtactaccatccacactcatatc
acggacgactggatggactgcgctttcccctgtggtgtaggctgccgaggccggggcgag
tacccatgtcttcaggtgtttgtgaacgtcacccattcaggtcagaaagctctcctacat
tataatgaagaggctgtccagataaattccaagtgcttttacacacccaagtgccaccga
gataggaatgatttgctcaacagtgtgctggacataaaggaattctttgatcacaaaaac
gggacgcccttttcatgcttctacagtccagacagccaatctgaagatgtcattctcata
aaaaagtacaaccagatggttatctttcactgtttattttggccttcactgactctgcta
gggggtgccctgattgttggcatggtgagattaacacagtacctgtccctgctgtgtgaa
aaatacagcgttgcactcagagatgaggtaggtggcaaagtaccttatatggaacagcat
cgattcaaactgtggagtgtggggagggacaaagaaaggggcagaaagatcttaagacag
tggccagattaa

DBGET integrated database retrieval system