KEGG   Felis catus (domestic cat): 101097167Help
Entry
101097167         CDS       T02385                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
fca  Felis catus (domestic cat)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:fca04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:fca04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C2
AA seq 285 aa AA seqDB search
MGWYMFPFLYGLIEISPSYFLQRTAFSASGRNRNIDHDDGDLPDVHKKLPSSAGEDRALL
LGFAMMGFSVLMFFLFGITILKPFMLSIQREESNCTTIHTHITDDWMDCAFPCGVGCRGR
GEYPCLQVFVNVTHSGQKALLHYNEEAVQINSKCFYTPKCHRDRNDLLNSVLDIKEFFDH
KNGTPFSCFYSPDSQSEDVILIKKYNQMVIFHCLFWPSLTLLGGALIVGMVRLTQYLSLL
CEKYSVALRDEVGGKVPYMEQHRFKLWSVGRDKERGRKILRQWPD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggttggtatatgtttccatttctctatgggcttattgaaatatctccttcctacttc
ctccaaaggacagccttttctgcctcaggcagaaatagaaatatagaccacgatgatgga
gacttaccagatgtgcacaagaagctgccatccagtgctggagaggaccgagccttgctg
ctgggctttgcaatgatgggcttctcagtcctcatgttcttcttgtttggaattaccatc
ctaaagcctttcatgctcagcattcagagagaagagtcgaactgtactaccatccacact
catatcacggacgactggatggactgcgctttcccctgtggtgtaggctgccgaggccgg
ggcgagtacccatgtcttcaggtgtttgtgaacgtcacccattcaggtcagaaagctctc
ctacattataatgaagaggctgtccagataaattccaagtgcttttacacacccaagtgc
caccgagataggaatgatttgctcaacagtgtgctggacataaaggaattctttgatcac
aaaaacgggacgcccttttcatgcttctacagtccagacagccaatctgaagatgtcatt
ctcataaaaaagtacaaccagatggttatctttcactgtttattttggccttcactgact
ctgctagggggtgccctgattgttggcatggtgagattaacacagtacctgtccctgctg
tgtgaaaaatacagcgttgcactcagagatgaggtaggtggcaaagtaccttatatggaa
cagcatcgattcaaactgtggagtgtggggagggacaaagaaaggggcagaaagatctta
agacagtggccagattaa

DBGET integrated database retrieval system