KEGG   Felis catus (domestic cat): 101097289Help
Entry
101097289         CDS       T02385                                 

Gene name
USP12
Definition
ubiquitin specific peptidase 12
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101097289 (USP12)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101097289 (USP12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 355 aa AA seqDB search
MGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPR
KKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNYMQQDAHEFLNYLLNT
IADILQEERKQEKQNGRLPNGNIDSENNSSPPDPTWVHEIFQGTLTNETRCLTCETISSK
DEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQEAHKRMKVKKLPMIL
ALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNR
GHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaatgcctcggcattagagaaagagattggtccagaacagtttccagtcaat
gagcactattttggattagtcaattttgggaatacctgctactgtaattcagttcttcaa
gcactttatttttgtcgtccgtttcgggaaaaagttctagcttacaagagccaacctagg
aagaaggagaaccttcttacctgcctagcagacctcttccatagcatagccactcagaag
aagaaggttggggtgattcctcctaagaagttcataacaagattacggaaggaaaatgaa
ctttttgacaactacatgcaacaagatgcccatgaattcttaaattacctactaaataca
attgctgatatcttacaagaagagagaaagcaggaaaagcaaaatggccgtttacccaac
ggtaatatcgacagcgaaaataacagcagcccaccagacccaacgtgggttcatgagatt
tttcagggaacattaacaaatgaaaccagatgtcttacttgtgaaaccataagcagcaaa
gatgaagattttttagacctttctgttgacgtggaacaaaacacatcgatcactcactgc
ttaaggggttttagcaacacagaaactctgtgcagtgaatacaaatattactgtgaagaa
tgtcgcagcaaacaggaggcacacaaacggatgaaagttaaaaaactgcccatgattcta
gctctgcacctgaagaggtttaagtacatggatcaacttcatcgatacacaaaactgtct
taccgggtagtttttcctttagaacttcgtctgtttaacacctctggcgacgcaaccaat
cctgacagaatgtacgacctcgtcgccgtggtggttcactgtggaagtggtcccaatcga
ggacattatatcgcaatagttaagagtcatgatttttggttgttgtttgatgacgacatt
gtagaaaaaattgatgcacaagctattgaagaattctacgggttgacatcagatatctca
aagaactctgagtctggttacatccttttctatcagtctcgggactga

DBGET integrated database retrieval system