KEGG   Felis catus (domestic cat): 101097357Help
Entry
101097357         CDS       T02385                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Gap junction
IL-17 signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Fluid shear stress and atherosclerosis
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101097357 (MAPK7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101097357 (MAPK7)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    101097357 (MAPK7)
  Endocrine system
   04912 GnRH signaling pathway
    101097357 (MAPK7)
   04921 Oxytocin signaling pathway
    101097357 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    101097357 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101097357 (MAPK7)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101097357 (MAPK7)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101097357 (MAPK7)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101097357 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 805 aa AA seqDB search
MAEPLKEEEGEDGSGEPPGPVKAEPTNTAACVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPLPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPXTPAPAHAPVPAPTPAQPT
SPPAGPPPQPVGSTSGPPPQPACPPPGPAPHPASPPGPVPGPAPLQNAASSLLAPQSLVP
PAGLPGPSSVGVLPYFPSGPPPPDPGGAPQPSTSESPDVNLVTQQLSKSQVEDPLPPVFS
GTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPAD
IESLQREIQMDSPMLLADLPDLQEP
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacccctgaaggaggaagaaggcgaggacggctctggggagccgcccgggccg
gtgaaggcggaacccaccaacaccgctgcctgtgtagcggccaagaacctggccctgctg
aaagcgcgctccttcgatgtgacctttgacgtgggggacgagtacgagatcattgagacc
ataggcaacggggcctatggggtggtgtcctcagctcgccgacgtctcaccggccagcag
gtggccattaagaagatccctaatgcttttgacgtggttaccaatgccaagcggaccctc
agggagctgaagatcctcaaacacttcaagcacgacaacatcatcgccatcaaggacatc
ttgaggcccacggtgccctacggggagttcaaatctgtctacgtggtcctggacctgatg
gagagcgacctgcaccagatcatccattcctcccagccactcactctggagcacgtgcgc
tacttcctgtaccagctgcttcggggcctcaagtacatgcactcggctcaggtcatccac
cgcgacctcaagccctccaacctgttggtgaatgagaattgtgagctcaagatcggtgac
tttggcatggcccgcggcctgtgcacctcgccggctgagcaccagtactttatgactgag
tatgtggccacgcgctggtaccgtgctcctgagctcatgctctcactgcatgagtacacg
caggccatcgacctgtggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaattatgtgcaccaactgcagctgatcatgatggtgctgggtact
ccatcgccggccgtgattcaggccgtcggggctgagagggtgcgggcctatatccagagc
ctgccgccacgtcagcccgtgccctgggagacagtgtacccaggcgctgaccgccaggcc
ctctcactgttggggcgcatgctgcgttttgagcccagcgcccgcatctccgcagccgct
gcccttcgccaccccttcctggccaagtaccacgatcccgatgatgagcccgactgtgcc
ccgccttttgatttcgcctttgaccgtgaagccctcacccgggagcgcattaaagaggcc
atcgtggctgagattgaggacttccacgcgcgacgcgagggcatccgccagcagatccgc
ttccagccttccctgcagcctgtggccagtgagcctggctgtcccgacgttgagatgccc
agcccctgggctcccagcggggactgtgccatggagtcccctccgccagccccgccgccg
tgtcctggcccggcacccgacactatcgatctgaccctgcagccacccctgcccgccagt
gaaccagcccctccgaagaaagagggcgccatctcagacaacaccaaggcggccctcaaa
gctgccctgctcaagtccttgcggagccgactccgagatggccccagtgctcctctggaa
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaggagcgagccaaggagcgggagaagcggcggcaggaacgggagcgc
aaggagcggggggccggggcctctgggggtccctccactgatcccctggccgggctggtg
ctcagtgacaatgatcgcagcctgttggagcgctggactcgcatggcccggcccccagcc
cccnncacaccggccccggcccacgccccagtcccggcccccaccccagcccagcccacc
agtcctccggctggccccccaccgcaacctgtaggctccacctctggccccccaccacag
cctgcttgcccaccccctggccctgctccccaccctgccagccctccggggcccgtccct
ggccctgctccactccagaatgccgcctctagcctcctggctccccagtcgcttgtgcca
cccgctgggctgcctggccccagctctgtaggtgttctgccttacttcccatctggcccg
ccccctccagaccccggaggggcccctcaaccctccacctcagaatcgcccgatgtcaac
ctggtgacccagcagttgtccaagtcacaggtggaggaccccttgcccccggtcttctcg
ggcactccgaagggcagtggggccggctatggtgttggctttgacctggaggaattccta
aaccagtctttcgacatgggcgtggctgacgggccacaggatggccaggcagactcggcc
tcactctcggcttccctgcttgctgactggctggagggccatggcatgaaccctgccgac
attgagtccctgcagcgtgagatccagatggactccccaatgctgctggctgacctgcct
gacctccaggagccctga

DBGET integrated database retrieval system