KEGG   Felis catus (domestic cat): 101097420Help
Entry
101097420         CDS       T02385                                 

Gene name
PRKG1
Definition
(RefSeq) protein kinase, cGMP-dependent, type I
  KO
K07376  
cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
fca  Felis catus (domestic cat)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Regulation of lipolysis in adipocytes
Salivary secretion
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    101097420 (PRKG1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101097420 (PRKG1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101097420 (PRKG1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101097420 (PRKG1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    101097420 (PRKG1)
  Digestive system
   04970 Salivary secretion
    101097420 (PRKG1)
  Nervous system
   04730 Long-term depression
    101097420 (PRKG1)
  Sensory system
   04740 Olfactory transduction
    101097420 (PRKG1)
  Environmental adaptation
   04713 Circadian entrainment
    101097420 (PRKG1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101097420 (PRKG1)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   101097420 (PRKG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D2
AA seq 694 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSAGTLQGEPRTKRQAISAEPTAFDLQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEVCLGGELWTILRDRPIPFDLLTSAGI
HPERLLSWERKDNHTHQHTTVPMAQPLSRQHRGKTLPCGAPTAVDFGFAKKIGFGKKTWT
FCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMI
EFPKKIVKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPII
PSVASPTDTSNFDSFPEDSDEPPPDDNSGWDIDF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccctgcgggatttgcagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgcgctcatcgacgagctggagctggagttggaccagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccggccggccacccagcaggcg
cagaagcagagcgccggcacgctgcagggcgagccgcgcaccaagcgccaggcgatctcc
gccgagcccaccgccttcgacctgcaggacctcagccacgtgaccctgcccttctacccc
aagagcccacagtccaaggatctcatcaaggaagctatccttgacaatgactttatgaag
aacttggagctgtcgcagatccaggagattgtggattgtatgtacccagtggaatatggc
aaagacagctgcatcatcaaagaaggagacgtggggtcactggtgtatgtcatggaagat
ggtaaggtggaagtcaccaaagaaggtgtgaagctgtgcaccatgggtccaggaaaggtg
ttcggagagctggcaattctttacaactgtacccggacagctaccgtcaagactcttgtg
aatgtgaaactctgggccatcgatcgacaatgttttcaaacaatcatgatgaggacagga
ctcatcaaacacaccgagtatatggaatttttaaaaagtgtcccaacgttccagagcctt
cctgaagagatcctcagtaagcttgccgatgtcctcgaagagacccactatgagaatggg
gagtatatcatcaggcaaggtgccagaggggacacgttctttatcatcagcaaaggcacg
gtaaatgtcactcgggaagactcaccaagtgaagacccggtctttcttagaactttaggg
aaaggagactggtttggagagaaggcattgcaaggggaggatgtgaggacagccaacgta
atcgctgcagaggctgtgacctgcctggtcatcgacagagactctttcaagcatttgatt
ggaggactggatgacgtgtctaataaagcctatgaggacgcagaagctaaagcaaaatac
gaagccgaagccgctttcttcgccaacctgaagctgtctgacttcaacatcatcgacacc
cttggagtcgggggcttcggacgagtagagctggtccagctgaaaagcgaggagtccaag
acgtttgccatgaagattctcaagaaacgccacatcgtggacaccagacaacaggagcac
attcgctcggagaagcagatcatgcagggggctcattccgacttcatagtgagactgtac
aggacgttcaaggacagcaaatatttgtatatgttgatggaagtgtgcctaggtggagag
ctctggaccattctcagggatagacccatcccattcgacctgctcacctcagccggcatc
catccggagcgactcctgtcctgggagagaaaagataatcacacacaccagcacaccaca
gttccaatggcccagcctttgagccgccagcacaggggaaaaaccctgccctgtggtgca
cccacagctgttgattttggctttgcaaagaaaataggatttggaaagaaaacatggact
ttttgtgggactccagagtacgtggctccagagatcatcctgaacaaaggccatgacatt
tcagccgactactggtcactgggaatcctaatgtatgaacttctgactggcagcccgcca
ttctcaggcccagaccctatgaaaacctataacatcatactgagggggattgacatgata
gaatttccaaagaagattgtcaaaaatgctgctaatttaattaaaaaactatgcagggat
aacccatcggaaagactagggaatttgaaaaatggcgtcaaagacattcaaaagcacaaa
tggtttgagggctttaactgggaaggcttaagaaaaggcaccttgacacctcctataata
ccaagcgttgcatcacccacagacacaagcaattttgacagtttccctgaggacagtgat
gaaccaccacctgacgacaactcgggctgggacatagacttctaa

DBGET integrated database retrieval system