KEGG   Felis catus (domestic cat): 101097705Help
Entry
101097705         CDS       T02385                                 

Gene name
PNPLA6
Definition
(RefSeq) patatin-like phospholipase domain containing 6
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101097705 (PNPLA6)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101097705 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1340 aa AA seqDB search
MDSGLPDLPPSLKQLMEAPLQTGMVLGVMIGAGVAVLVTAVFILLLVRRLRVQKTPAPDG
PRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDASVSTTSRPRMKKKLKMLNIAKKILRIQK
EAPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYMLKNVRVLGHFEKPLFLELCRHMVF
QRLSQGDYVFRPGQPDASIYVVQDGLLELCLPGPDGKECVVKEVVPGDSVNSLLSILDVI
TGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYPESLVRVVQIIMVRLQRVTFLALHN
YLGLTNELFSHEIQPLRLFPSPGLPARTSPVRGSKRVVSASTTEEPRETPGRPPDPTGAP
LPGPAGDPVKPTSLEAPSAPLLSRCISLPVDISGLQGGPRSDFDMAYERGRISVSLQEEA
SGGPQAAPARTPTQEPREQPAGACEHSFCEEELATGGCPFGPYQGRQTSSIFEAAKRELA
KLMRIEDPSLLNSRVLLHHAKAGTVIARQGDQDVSLHFVLWGCLHVYQRMIDKAEDVCLF
VAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISKSDFYEIMRAQPSVVLSAAHTVAAR
MSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIVLNGRLRSVIQRGSGKKELVGEYGR
GDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLGHIKRRYPQVVTRLIHLLSQKILGN
LQQLQGPFPAGSGLGVPPHSELTNPASNLATVAVLPVCAEVPMVAFTLELQHALQAIGPT
LLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAHRIVLYQTDASLTPWTVRCLRQADC
ILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHREEGAGPTRTVEWLNMRSWCSGHLH
LRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSRLARVLTGNTIALVLGGGGARGCSH
IGVLKALEEAGVPVDLVGGTXXXXXALYAEERSASRTKQRAREWAKNMTSVVEPVLDLTY
PVTSMFTGSAFNRGIHRVFQDKQIEDLWLPYFNVTTDITASAMRVHKDGSLWRYVRASMT
LSGYLPPLCDPKDGHLLMDGGYINNLPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLS
GWWLLWKRLNPWTDKIKVPDMAEIQSRLAYVSCVRQLEVVKSSSYCEYLRPPIDCFKTMD
FGKFDQIYDVGYQYGKAVFGGWSRGDIIEKMLTDRRSADLNESRRADVLAFPSSGFTDLA
EIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEK
SILRHRRCPPPDPPSSAVDA
NT seq 4023 nt NT seq  +upstreamnt  +downstreamnt
atggactctgggctaccagacctgcctcccagtctgaagcaactgatggaggctccgctg
caaaccggaatggtgctgggcgtgatgattggggctggagtcgcggtgctggtcactgcc
gtattcatcctcctgctggtgcggagactgcgagtgcagaagactccagccccggatggt
cccaggtatcgattccggaagagggacaaagtgcttttctatggtcggaagattatgcgg
aaggtatcacaatccacttcctccctggtggatgcttcggtctccaccacttcccggcca
cgcatgaagaagaaacttaagatgctcaacattgccaagaagatcctgcgcatccaaaaa
gaggccccaacactgcaacggaaggagcccccgcccgcggtgcttgaagctgacttgacg
gagggtgacctggctaactcccacctgccctccgaggtgctctacatgctcaagaatgtc
cgggtgctgggccacttcgagaagccgctcttcctggagctctgccgacacatggtcttc
cagcggctcagccagggtgactacgtcttccggccaggccagccggatgccagtatctat
gtggtgcaggatgggctgctggagctctgtctgccagggcctgacgggaaggagtgtgtg
gtgaaggaagtggtccctggggacagtgtcaacagcctcctgagcatcctggacgtcatc
accggccaccagcacccccagcgcactgtgtccgcccgggcggcccgagactccacggtg
ctgcggctgccagtggaggccttctctgccgtgttcaccaagtaccccgagagcttggtg
cgggtggtgcagattatcatggtgaggctgcagcgggttaccttcctggcgctccacaac
tacctgggtctgaccaatgagctcttcagccacgagatccagcccctgcgcctcttcccc
agccctggcctcccagcccgcaccagccccgtgcgtggctccaagcgggtggtcagcgcc
tccaccactgaggagccaagggagactcccggccggccacctgaccccactggggccccg
ctgcctggacctgcaggggacccggtgaagcccacctctctggaggccccctccgccccg
ctgctgagtcgctgcatctccctgccagtggacatctcaggcttgcagggtggcccccgc
tcggactttgacatggcgtatgagcgtggccggatctccgtgtccctgcaggaagaggct
tcaggggggccccaggcggctcccgctcggacccccactcaggagccccgggagcagcca
gcgggtgcctgtgagcacagcttctgtgaggaggagttggccacggggggttgccccttc
gggccctaccagggacgccagacaagcagcatctttgaggcggcgaagcgggagctggcc
aaactgatgcggatcgaggacccctccctcctcaacagccgggtcctgctccatcatgcc
aaagctggcaccgtcatcgcccgccagggggaccaggatgtgagcctgcactttgtgctg
tggggctgcctgcacgtgtatcagcgtatgatcgacaaggcggaggacgtgtgcctgttc
gtggcacaacccggagagctggtgggtcagctggcggtgctcaccggggagccccttatc
ttcacactgagagcccagcgagactgcaccttcctgaggatctctaagtctgacttctat
gagatcatgcgtgcacagcccagtgtggtgctgagcgccgcgcacacggtggccgcgagg
atgtcgcccttcgtgcgccagatggactttgccatcgactggacggcggtggaggcggga
cgcgctttgtacaggcagggcgaccgctccgactgcacctacatcgtgctcaatgggcgg
ctgcgcagcgtcatccagcgcggcagcggcaagaaggagttggtgggcgagtacggccgc
ggcgacctcattggcgtggtggaggcgctgacacgacagcctcgtgccacgacggtgcac
gcggtgcgcgacacggagctggccaaactccccgagggcaccctgggccacatcaaacgt
cgttacccgcaggtcgtaacccgcctcatccacctgctaagccagaaaattttggggaat
ttgcagcagctgcaaggacccttcccggcaggctcgggactcggcgtcccccctcactcg
gaacttaccaacccagccagcaacttggccaccgtggcggtcctgccagtgtgcgccgag
gtgcccatggtggccttcaccctggagctgcagcatgctctgcaagcgattggtccaacc
cttctcctcaacagtgacatcatccgggcccgcctaggggcttctgccctggatagcatc
caagagttccggctgtcagggtggctggcccagcaggaggatgcccaccgcatagtgctg
taccagactgacgcgtcgctgacaccctggactgtgcgctgcctacgccaggccgactgc
atcctcatcgtgggcctgggtgaccaggagcccactcttggccagctggagcagatgctg
gagaacacggcggtgcgcgccctcaagcagctggtgctgctgcaccgggaggagggcgcg
ggccccacgcgcaccgtcgagtggctcaacatgcggagctggtgctcggggcacttgcat
ctgcgctgtccacgccgcctcttctctcgccgcagcccagccaagttgcacgagctctat
gagaaggttttctcgaggcgcgcggaccggcacagcgacttttcccgcctggcgcgggtg
ctcacaggcaacaccatcgccctggtgctgggcgggggcggcgccaggggctgctcacac
atcggcgtgctgaaggcattggaggaggcaggggtccccgtcgacctggtgggcggcacg
nntnnnnnnnnnngtgccctgtacgctgaggagcgaagtgccagccgcactaagcagcgg
gcccgggagtgggccaagaacatgacttcggtggtggagccggtgctggacctcacgtac
cctgtcacctccatgttcaccgggtcggccttcaaccgcggcattcaccgcgtcttccag
gacaagcagatcgaggacctgtggctgccgtacttcaacgtgaccacggacatcaccgcc
tcagccatgcgcgtccacaaagatggctccctgtggcgatacgtacgcgccagcatgacg
ctgtcgggctacctgcccccgctgtgcgacccgaaggacgggcacctcctcatggacggc
ggctacatcaacaacctgccagcggacatcgcccgcagcatgggtgccaagacggtcatc
gccattgatgtggggagccaggatgagacagacctcagtacctacggggacagcctgtct
ggctggtggctactgtggaagcggctaaacccctggacagacaagatcaaggttccagac
atggctgagatccagtctcgcctggcctacgtgtcctgcgtgcggcagctggaggttgtg
aagtccagctcctactgcgagtacctgcgcccgcccatcgactgcttcaagaccatggac
ttcgggaagttcgaccagatctatgatgtgggctaccagtacgggaaggctgtgtttggg
ggctggagcaggggcgacatcattgagaagatgctcacggaccggcggtctgctgacctc
aatgagagccgccgtgcggatgtgctggccttccccagctctggcttcaccgacttggca
gagatcgtgtcccgtattgagccgcccacaagctacgtttccgacggctgtgctgatgga
gaggagtcagattgcctgacagagtatgaggaagacgcagggcctgactgctcgcgggac
gaagggggctctcccgagggcgccagccccagcaccgcctctgagatggaggaggagaag
tcaattctccggcaccggcgctgcccgcccccggaccctcccagctcggctgtggatgcc
tga

DBGET integrated database retrieval system