KEGG   Felis catus (domestic cat): 101097719Help
Entry
101097719         CDS       T02385                                 

Gene name
ADI1
Definition
acireductone dioxygenase 1
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
fca  Felis catus (domestic cat)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:fca00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A3
AA seq 172 aa AA seqDB search
MSKVESWRMSCRWSSWRGGLSTVQSLQQQNGHELDADRYENDPELEKIRKERNYSWMDII
TICKDKLPDYEEKIKMFYKEHLHLDDEIRYILDGSGYFDVRDKEDKWVRIFMEKGDMITL
PAGIYHRFTLDEKNYVKAMRLFVGEPVWTAYNRPADHFEVRGQYVEFLAQTE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaggtggaatcctggaggatgagctgtcgctggtcgagctggagaggcgggctc
tccactgtgcagtcgctgcagcagcagaacggacacgaacttgatgctgacagatacgag
aatgatccagagttagaaaagatccgaaaagagagaaactattcctggatggacataata
accatatgcaaggataaactaccagattatgaagaaaagatcaagatgttctacaaggag
cacctgcacctggacgacgagatccgctacatcttggacggcagcggctactttgatgtg
agggacaaggaggacaagtgggtccgcatcttcatggagaaaggagacatgatcaccctt
cccgctgggatctatcaccgcttcacgctggatgaaaagaactacgtgaaagccatgcgg
ctgtttgtgggagaaccggtgtggacggcgtacaaccggccggccgaccatttcgaggtt
cgggggcagtacgtggaattcttggcgcagacggagtag

DBGET integrated database retrieval system