KEGG   Felis catus (domestic cat): 101097756Help
Entry
101097756         CDS       T02385                                 

Gene name
USP28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 924 aa AA seqDB search
MREAASAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLPE
FRRLVLSYSLPQNVLENCPSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALDLLKGA
FRSPEEQQQDVSEFTHKLLDWLEDAFQLAVNVNNPRNKSENPMVQLFYGTFLTEGVREGK
PFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDIDLLPSDHSVKYGQERWFTKLPPVLTF
ELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYKSKELIRSKRECIRKLKEEIKVLQQK
LERYVKYGSGPARFPLPDMLKYVIEFASTKPASESSTSQSDHVTLPLSSVHCPVSDLASK
ESTSKESPSQDVEGTFSSPEDSLPKSKAMNKPFTSSRSSMEMPAHPAPRTVTEDEINFVK
TCLQRWRSEIEQDIQDLKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYW
AYIYNQPRQVWLKYNDISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFNAEAAPI
ESDQMLGEVDALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSSSSVSQDFSTSP
EPSVASSHGVRCLSSEHAVIAKEQTAQAIANTAHAYERGGVEAALNEAFHEEYSRLYQLA
KETPTAHSDPRLQHVLVYFFQNEAPKRVVERTLLEQFADKNLSYDERSISIMKVAQAKLQ
EIGPEDMNMEEYKKWHEDYSLFRKVSVYLLTGLELYQKGKYQEALSYLVYAYQSNAALLT
KGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEGINVMNELIIPCIHLIINN
DISKDDLHAIEIMRNHWCSYLGQDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNS
PYDLCSRFAAVMESIQGVSTVTVK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggcagcctctgcagaaactaaacgctcaaagagaaaacgctgtgaagtctgg
ggagaaaatcccaatcccaacgactggaggagagttgatggttggccagttggactgaag
aatgttggcaatacatgttggtttagtgctgttattcagtctctcttccaactgcctgaa
tttcgaagacttgttctcagctatagcctgccacagaatgtacttgaaaactgtccaagt
cacacggaaaagagaaatatcgtgtttatgcaagagcttcagtacttgtttgctctgatg
atgggatcaaatcgcaaatttgtagacccttccgcagccctggatctcttaaagggagca
ttccgatcacctgaggaacagcagcaagatgtgagtgaattcacacacaagctcctggat
tggctggaggacgcattccagctagctgttaacgttaacaatcccaggaacaaatctgaa
aacccaatggtgcagctattctacgggactttcctcactgaaggggttcgtgaaggaaag
cccttttgtaacaatgagaccttcggccagtatccccttcaggtaaatggttatcgcaac
ttagacgaatgtttggaaggggccatggtggagggggacattgacctgcttccttccgat
cattcggtgaagtatggacaagagcgttggtttacaaagctgcctccagtgttgaccttt
gagctctcaagatttgagttcaatcagtcgctcggtcagccagagaaaattcacaataag
ctggaatttcctcagatcatttatatggacaggtacatgtacaagagcaaagagcttatt
cgaagtaagagagagtgtattcgaaagttgaaggaggaaataaaagttctgcagcaaaaa
ctggaaaggtacgtgaagtacggctcaggcccagctcggtttccactcccggacatgctg
aaatacgttatcgaatttgccagtacaaaacctgcctcagaaagctccacgtctcaaagt
gaccacgtgacgttaccgctttcttcagtgcactgcccagtttctgacctggcatccaag
gagagtacaagtaaagaaagcccttctcaggatgtcgaaggtaccttttcttctcctgaa
gattctctacccaagtctaaggcaatgaataagccatttacatcgtcccggtcttccatg
gaaatgcccgcacatccggctcctcgaactgtcacagaggatgagataaactttgttaag
acctgtcttcagaggtggaggagtgagattgaacaagatattcaagatttaaagaattgt
attgcaagcactacccagactattgagcagatgtattgcgacccactccttcgtcaggtg
ccttatcgcttacacgcagttctcgttcatgaaggacaggccaatgctggacactactgg
gcctatatctataatcaaccccgacaagtctggctcaagtacaatgacatctctgttact
gaatcttcctgggaagaacttgaaagagattcttatgggggcctgagaaacgttagtgct
tactgtctgatgtacattaacgacaagctgccgcacttcaatgcagaggcggccccaatt
gaatcagatcagatgttgggagaagtggatgccctgtctgttgaactgaagcattacatt
caggaagataactggaggtttgagcaggaggtcgaggagtgggaagaagaacagtcctgc
aaaatccctcagatggaatcgtccagcagctcagtgtcccaggatttctccacatcccca
gagccctcagtagcctcttcccatggggtccgctgtttgtcttctgagcacgctgtgatc
gcaaaggagcagacggcgcaggcgattgccaacacagcacacgcctatgagcggggcggc
gtggaagccgcgctgaacgaggcattccacgaagagtactccaggctctaccagctggcc
aaggagacgcccacggcccacagcgaccctcggctccagcacgtgcttgtctactttttc
caaaatgaggcgcccaagagggtggtggaacggaccctcctggaacagtttgcagataaa
aatctcagctacgatgaaaggtccatcagcatcatgaaggtggcgcaggccaagctgcag
gagattggtccagaggacatgaatatggaagagtacaagaagtggcatgaggattatagt
ttgtttcgaaaggtgtctgtgtatctcctcacgggtctggaactctaccaaaaaggaaag
taccaagaggcactctcctacctggtatatgcctaccagagcaatgccgccctgctgacc
aaggggccccgccggggggtgaaggaatccgtcatcgctttgtaccgacgaaagtgcctt
ctggagctgaatgccaaggcagcttctctctttgaaacaaacgacgaccactctgtaaca
gagggcattaatgtgatgaatgagctgatcattccctgcattcaccttatcattaataat
gacatctccaaggatgacctacatgccattgagatcatgagaaaccattggtgctcttac
cttggacaagatattgcggaaaatctacagctgtgcttaggggagttcctacccaggctt
ctcgatccttctgcggaaatcattgtcctgaaggagcctccaactattcgacccaattct
ccctatgacctttgtagccgatttgcagctgtcatggagtcaattcagggggtgtcaact
gtgacagtgaagtaa

DBGET integrated database retrieval system