KEGG   Felis catus (domestic cat): 101097756Help
Entry
101097756         CDS       T02385                                 

Gene name
USP28
Definition
(RefSeq) ubiquitin specific peptidase 28
  KO
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101097756 (USP28)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101097756 (USP28)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 1122 aa AA seqDB search
MLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTEERVKEPGQDTVATEPSEVEGRA
ASKEVLAKVIDLTHDNKDDLQAAIALSLLESPNIQADGRDLNRMREAASAETKRSKRKRC
EVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLEN
CPSHTEKRNIVFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSPEEQQQDVSEFTHK
LLDWLEDAFQLAVNVNSNPRNKSENPMVQLFYGTFLTEGVREGKPFCNNETFGQYPLQVN
GYRNLDECLEGAMVEGDIDLLPSDHSVKYGQERWFTKLPPVLTFELSRFEFNQSLGQPEK
IHNKLEFPQIIYMDRYMYKSKELIRSKRECIRKLKEEIKVLQQKLERYVKYGSGPARFPL
PDMLKYVIEFASTKPASESSTSQSDHVTLPLSSVHCPVSDLASKESTSKESPSQDVEGTF
SSPEDSLPKSKAMNKPFTSSRSSMEMPAHPAPRTVTEDEINFVKTCLQRWRSEIEQDIQD
LKNCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYWAYIYNQPRQVWLKYND
ISVTESSWEELERDSYGGLRNVSAYCLMYINDKLPHFNAEAAPIESDQMLGEVDALSVEL
KHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSSSSVSQDFSTSPEPSVASSHGVRCLSSE
HAVIAKEQTAQAIANTAHAYERGGVEAALNELQEVEPEKPMSPETNPAGQTEQPPKAGDT
ESAAQPDSEASEVEIPSVGRILVRADADGYDEEVMLSPAMQGVILAIAKARQTFDRDGSE
AGLIKAFHEEYSRLYQLAKETPTAHSDPRLQHVLVYFFQNEAPKRVVERTLLEQFADKNL
SYDERSISIMKVAQAKLQEIGPEDMNMEEYKKWHEDYSLFRKVSVYLLTGLELYQKGKYQ
EALSYLVYAYQSNAALLTKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEG
INVMNELIIPCIHLIINNDISKDDLHAIEIMRNHWCSYLGQDIAENLQLCLGEFLPRLLD
PSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgctgttaaaccaactaagagaaatcacaggcattcaggacccttcctttcttcatgaa
gctctgaaggccagtaatggtgacatcacccaggcggtcagcctcctcactgaagaaaga
gttaaagagcccgggcaagacactgttgctacggaaccatctgaagtagaggggagagct
gctagcaaagaagtattagcaaaagtgatagaccttactcatgataacaaagatgaccta
caggctgccattgctttgagtctgttggagtcccccaacattcaagctgatggaagagat
ctgaacaggatgcgcgaggcagcctctgcagaaactaaacgctcaaagagaaaacgctgt
gaagtctggggagaaaatcccaatcccaacgactggaggagagttgatggttggccagtt
ggactgaagaatgttggcaatacatgttggtttagtgctgttattcagtctctcttccaa
ctgcctgaatttcgaagacttgttctcagctatagcctgccacagaatgtacttgaaaac
tgtccaagtcacacggaaaagagaaatatcgtgtttatgcaagagcttcagtacttgttt
gctctgatgatgggatcaaatcgcaaatttgtagacccttccgcagccctggatctctta
aagggagcattccgatcacctgaggaacagcagcaagatgtgagtgaattcacacacaag
ctcctggattggctggaggacgcattccagctagctgttaacgttaacagcaatcccagg
aacaaatctgaaaacccaatggtgcagctattctacgggactttcctcactgaaggggtt
cgtgaaggaaagcccttttgtaacaatgagaccttcggccagtatccccttcaggtaaat
ggttatcgcaacttagacgaatgtttggaaggggccatggtggagggggacattgacctg
cttccttccgatcattcggtgaagtatggacaagagcgttggtttacaaagctgcctcca
gtgttgacctttgagctctcaagatttgagttcaatcagtcgctcggtcagccagagaaa
attcacaataagctggaatttcctcagatcatttatatggacaggtacatgtacaagagc
aaagagcttattcgaagtaagagagagtgtattcgaaagttgaaggaggaaataaaagtt
ctgcagcaaaaactggaaaggtacgtgaagtacggctcaggcccagctcggtttccactc
ccggacatgctgaaatacgttatcgaatttgccagtacaaaacctgcctcagaaagctcc
acgtctcaaagtgaccacgtgacgttaccgctttcttcagtgcactgcccagtttctgac
ctggcatccaaggagagtacaagtaaagaaagcccttctcaggatgtcgaaggtaccttt
tcttctcctgaagattctctacccaagtctaaggcaatgaataagccatttacatcgtcc
cggtcttccatggaaatgcccgcacatccggctcctcgaactgtcacagaggatgagata
aactttgttaagacctgtcttcagaggtggaggagtgagattgaacaagatattcaagat
ttaaagaattgtattgcaagcactacccagactattgagcagatgtattgcgacccactc
cttcgtcaggtgccttatcgcttacacgcagttctcgttcatgaaggacaggccaatgct
ggacactactgggcctatatctataatcaaccccgacaagtctggctcaagtacaatgac
atctctgttactgaatcttcctgggaagaacttgaaagagattcttatgggggcctgaga
aacgttagtgcttactgtctgatgtacattaacgacaagctgccgcacttcaatgcagag
gcggccccaattgaatcagatcagatgttgggagaagtggatgccctgtctgttgaactg
aagcattacattcaggaagataactggaggtttgagcaggaggtcgaggagtgggaagaa
gaacagtcctgcaaaatccctcagatggaatcgtccagcagctcagtgtcccaggatttc
tccacatccccagagccctcagtagcctcttcccatggggtccgctgtttgtcttctgag
cacgctgtgatcgcaaaggagcagacggcgcaggcgattgccaacacagcacacgcctat
gagcggggcggcgtggaagccgcgctgaacgagcttcaggaagttgagcccgagaagccc
atgtccccggaaacaaaccccgcagggcagactgagcagcccccaaaggctggtgacaca
gagtctgctgcccagcctgactctgaggcctctgaagtcgagattcccagtgtgggaagg
attctggttagagcggacgcagatggatatgatgaggaggtgatgctgagccctgccatg
caaggggtcatcctggccatagctaaagcccgtcagacctttgaccgagatgggtctgaa
gcagggcttattaaggcattccacgaagagtactccaggctctaccagctggccaaggag
acgcccacggcccacagcgaccctcggctccagcacgtgcttgtctactttttccaaaat
gaggcgcccaagagggtggtggaacggaccctcctggaacagtttgcagataaaaatctc
agctacgatgaaaggtccatcagcatcatgaaggtggcgcaggccaagctgcaggagatt
ggtccagaggacatgaatatggaagagtacaagaagtggcatgaggattatagtttgttt
cgaaaggtgtctgtgtatctcctcacgggtctggaactctaccaaaaaggaaagtaccaa
gaggcactctcctacctggtatatgcctaccagagcaatgccgccctgctgaccaagggg
ccccgccggggggtgaaggaatccgtcatcgctttgtaccgacgaaagtgccttctggag
ctgaatgccaaggcagcttctctctttgaaacaaacgacgaccactctgtaacagagggc
attaatgtgatgaatgagctgatcattccctgcattcaccttatcattaataatgacatc
tccaaggatgacctacatgccattgagatcatgagaaaccattggtgctcttaccttgga
caagatattgcggaaaatctacagctgtgcttaggggagttcctacccaggcttctcgat
ccttctgcggaaatcattgtcctgaaggagcctccaactattcgacccaattctccctat
gacctttgtagccgatttgcagctgtcatggagtcaattcagggggtgtcaactgtgaca
gtgaagtaa

DBGET integrated database retrieval system