KEGG   Felis catus (domestic cat): 101097903Help
Entry
101097903         CDS       T02385                                 

Gene name
CDK4
Definition
cyclin-dependent kinase 4
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101097903 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101097903 (CDK4)
   04115 p53 signaling pathway
    101097903 (CDK4)
  Cell communication
   04530 Tight junction
    101097903 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    101097903 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101097903 (CDK4)
   05203 Viral carcinogenesis
    101097903 (CDK4)
   05212 Pancreatic cancer
    101097903 (CDK4)
   05214 Glioma
    101097903 (CDK4)
   05220 Chronic myeloid leukemia
    101097903 (CDK4)
   05218 Melanoma
    101097903 (CDK4)
   05219 Bladder cancer
    101097903 (CDK4)
   05222 Small cell lung cancer
    101097903 (CDK4)
   05223 Non-small cell lung cancer
    101097903 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    101097903 (CDK4)
   05162 Measles
    101097903 (CDK4)
   05161 Hepatitis B
    101097903 (CDK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101097903 (CDK4)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   101097903 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGASGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggccgagattggtgttggtgcttatggaaccgtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtccct
aacggaggaggtgctagcgggggccttcccatcagcacagttcgtgaggtggccttactg
aggcggctggaggcttttgaacatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgaccgagagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagactatcaaggatctg
atgcgccagtttctaagaggcctagatttcctccatgccaactgcattgttcatcgagat
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctatcagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcagtctacgtacgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagaggaccccgtccagtgcagtcagtg
gtacctgagttggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system