KEGG   Felis catus (domestic cat): 101097903Help
Entry
101097903         CDS       T02385                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4 isoform X2
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04110  Cell cycle
fca04115  p53 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04218  Cellular senescence
fca04530  Tight junction
fca04660  T cell receptor signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing's syndrome
fca05161  Hepatitis B
fca05162  Measles
fca05165  Human papillomavirus infection
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05212  Pancreatic cancer
fca05214  Glioma
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
Module
fca_M00692  Cell cycle - G1/S transition
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101097903 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101097903 (CDK4)
   04115 p53 signaling pathway
    101097903 (CDK4)
   04218 Cellular senescence
    101097903 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    101097903 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    101097903 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101097903 (CDK4)
   05203 Viral carcinogenesis
    101097903 (CDK4)
   05212 Pancreatic cancer
    101097903 (CDK4)
   05225 Hepatocellular carcinoma
    101097903 (CDK4)
   05214 Glioma
    101097903 (CDK4)
   05220 Chronic myeloid leukemia
    101097903 (CDK4)
   05218 Melanoma
    101097903 (CDK4)
   05219 Bladder cancer
    101097903 (CDK4)
   05224 Breast cancer
    101097903 (CDK4)
   05222 Small cell lung cancer
    101097903 (CDK4)
   05223 Non-small cell lung cancer
    101097903 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101097903 (CDK4)
   04934 Cushing's syndrome
    101097903 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    101097903 (CDK4)
   05162 Measles
    101097903 (CDK4)
   05161 Hepatitis B
    101097903 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101097903 (CDK4)
   05165 Human papillomavirus infection
    101097903 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    101097903 (CDK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101097903 (CDK4)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101097903 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 101097903
NCBI-ProteinID: XP_003989014
Ensembl: ENSFCAG00000029663
UniProt: M3WUQ1
Position
B4
AA seq 303 aa AA seqDB search
MATPRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGASGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFSPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctcgatatgagccagtggccgagattggtgttggtgcttatggaaccgtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtccct
aacggaggaggtgctagcgggggccttcccatcagcacagttcgtgaggtggccttactg
aggcggctggaggcttttgaacatcccaatgttgtccggctgatggatgtctgtgccact
gcccgaactgaccgagagaccaaagtgaccctggtgtttgagcatgtggaccaagaccta
aggacatatctggacaaggcacccccaccaggcttgccagtggagactatcaaggatctg
atgcgccagtttctaagaggcctagatttcctccatgccaactgcattgttcatcgagat
ctgaagccagagaacattctggtgacaagtggtgggacagtcaagctggctgactttggc
ctggccagaatctacagctatcagatggcacttacacctgtggttgttacactctggtac
cgtgctccggaagttcttctgcagtctacgtacgcaacacctgtggacatgtggagcgtt
ggctgtatcttcgcagagatgtttcgtcgcaagcctctcttctgtggaaactctgaagct
gaccagttaggcaaaatctttgacctgatcgggctgcccccagaggatgactggccccga
gatgtgtctctgccccgaggagccttttcccccagaggaccccgtccagtgcagtcagtg
gtacctgagttggaggagtctggagcacagctgctgctggagatgctgacttttaaccca
cacaagcgaatctctgccttccgagccctgcagcactcttatctacaaaaggcagaaggt
aacccagagtga

DBGET integrated database retrieval system