KEGG   Felis catus (domestic cat): 101098110Help
Entry
101098110         CDS       T02385                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
F1
AA seq 339 aa AA seqDB search
MTQPPPTKAPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHP
LTRWALQHQPPSPKQLEEEFLKIPSNFVNSEDLDIPGHASKDRYKTILPNPQSRVCLGRA
QSQEDGDYINANYIRGYDGQEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGK
EKCVHYWPTEEETYGPFRIRIQGTKECPEYTVRQLTIQHQEECRVVKHVLFSAWPDHQTP
ESAGPLLRLVAEVEESPETAANTGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILG
IVCQLRLDRGGMIQTTEQYQFLHHTLALYAAQLPEEPCP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctccacccaccaaagcaccagccaagaagcatgtgcgactgcaggagagg
cgaggctccaatgtggctctgatgctggatgtgcggtccctgggagctgtagagcccatt
tgctcagtgaacacaccccgggaggtcaccctacactttctgcgcacagctggacacccc
ctcacccgctgggccctgcagcaccagccacccagccccaagcagctggaagaggaattc
ctgaagatcccctcaaactttgtcaactctgaagacctggatattcctggccacgcctcc
aaggaccgatataagaccatcttgccaaatccccagagccgcgtctgtctaggccgggca
cagagccaagaagacggagactacatcaatgccaactacatccgaggctacgacgggcag
gagaaggtctacattgcgacccagggccccatgcccaacaccgtatcggacttctgggag
atggtgtggcaggaagaagtgtcactcattgtcatgctcactcagctccgagaaggcaag
gagaaatgtgtccactactggcccacagaagaggaaacctatggacccttccggatccgc
atccaaggcacaaaagaatgtccagaatacactgtgcggcagctcaccatccagcaccag
gaggagtgccgggtagtgaaacatgtcctcttctctgcctggcctgatcaccagacccca
gaatcggctgggcctctgctgcgcctggtggccgaggtggaggaaagcccagagacagct
gccaacactgggcccatcgtagtccactgcagtgcagggattggccggactggctgcttc
atcgccacccgaattggctgtcaacagctgaaggcccgaggggaagtggacattctgggt
atcgtgtgccaactgcggctggacaggggcgggatgatccagaccacagagcaataccag
ttcctgcaccacaccctggccctgtatgcagcccagctaccggaggagccctgcccctga

DBGET integrated database retrieval system