KEGG   Felis catus (domestic cat): 101098152Help
Entry
101098152         CDS       T02385                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04066  HIF-1 signaling pathway
fca04072  Phospholipase D signaling pathway
fca04136  Autophagy - other
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04371  Apelin signaling pathway
fca04630  Jak-STAT signaling pathway
fca04659  Th17 cell differentiation
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca05165  Human papillomavirus infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05221  Acute myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101098152 (MTOR)
   04371 Apelin signaling pathway
    101098152 (MTOR)
   04630 Jak-STAT signaling pathway
    101098152 (MTOR)
   04066 HIF-1 signaling pathway
    101098152 (MTOR)
   04072 Phospholipase D signaling pathway
    101098152 (MTOR)
   04151 PI3K-Akt signaling pathway
    101098152 (MTOR)
   04152 AMPK signaling pathway
    101098152 (MTOR)
   04150 mTOR signaling pathway
    101098152 (MTOR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101098152 (MTOR)
   04136 Autophagy - other eukaryotes
    101098152 (MTOR)
  Cell growth and death
   04218 Cellular senescence
    101098152 (MTOR)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    101098152 (MTOR)
  Endocrine system
   04910 Insulin signaling pathway
    101098152 (MTOR)
   04920 Adipocytokine signaling pathway
    101098152 (MTOR)
   04919 Thyroid hormone signaling pathway
    101098152 (MTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    101098152 (MTOR)
   04213 Longevity regulating pathway - multiple species
    101098152 (MTOR)
  Environmental adaptation
   04714 Thermogenesis
    101098152 (MTOR)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101098152 (MTOR)
   05230 Central carbon metabolism in cancer
    101098152 (MTOR)
   05231 Choline metabolism in cancer
    101098152 (MTOR)
   05206 MicroRNAs in cancer
    101098152 (MTOR)
   05205 Proteoglycans in cancer
    101098152 (MTOR)
   05210 Colorectal cancer
    101098152 (MTOR)
   05212 Pancreatic cancer
    101098152 (MTOR)
   05225 Hepatocellular carcinoma
    101098152 (MTOR)
   05226 Gastric cancer
    101098152 (MTOR)
   05214 Glioma
    101098152 (MTOR)
   05221 Acute myeloid leukemia
    101098152 (MTOR)
   05215 Prostate cancer
    101098152 (MTOR)
   05224 Breast cancer
    101098152 (MTOR)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101098152 (MTOR)
   04931 Insulin resistance
    101098152 (MTOR)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101098152 (MTOR)
   05165 Human papillomavirus infection
    101098152 (MTOR)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101098152 (MTOR)
   01522 Endocrine resistance
    101098152 (MTOR)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101098152 (MTOR)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101098152 (MTOR)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101098152 (MTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME TMEM154 EPSP_synthase HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 101098152
NCBI-ProteinID: XP_003989538
Ensembl: ENSFCAG00000000053
UniProt: M3VU05
Position
C1
AA seq 2550 aa AA seqDB search
MLGTGPATATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAGQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIASEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRGWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANVTSTTTAATTAATATATATSTEGSNSESEAESTENS
PTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDV
NEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVA
SKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYF
GERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQ
AWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPHQPIIRIQSIAPS
LQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKN
LSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLT
LMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDR
HPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRIT
CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILD
GVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETL
DVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7653 nt NT seq  +upstreamnt  +downstreamnt
atgctgggaaccggacctgccaccgccaccacagccaccaccacgtccagcaacgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcggatgcc
aatgaaaggaaaggtggcatcttggccatagccagcctcataggagtggaaggcgggaat
gccacccgtatcggcagatttgctaactatcttcggaacctcctcccctctaatgaccca
gttgtcatggagatggcatccaaggccattggccgccttgccatggcaggcgacactttt
acagctgagtatgtggagttcgaggtgaagcgagccttggagtggctgggcgctgaccgc
aacgagggccggagacacgcagccgttctggttctccgcgagctggctatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgggagggagctgtggccgcccttcgtgcctgtttgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacgtttgaagaa
gccgagaaggggtttgatgagacgttggccaaggagaagggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaacgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacgcagcagcagctggtccatgacaagtactgc
aaagacctcatgggcttcgggacgaaacctcgtcacatcacccccttcaccagcttccag
gctggccagcccccgcagtccaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcatgggtttcggggcttcccccagcccagcgaagtccacgctggtggagagccgg
tgttgcagagacctgatggaggagaaattcgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcatttcgaccttctgccttcacagatacccagtacctccaagataccatgaaccacgtc
ttgagctgtgtcaagaaggagaaggagcggacagcagccttccaagccctggggctcctt
tctgtggctgtgagatctgagttcaaggtctatttgcctcgtgtgctggacatcatccga
gcagccttacccccaaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtacgacctgagccgtcagattccacagctgaagaaggacatccaggatgggctactg
aagatgctgtccctggtccttatgcacaaacccctccggcacccgggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacagccctccctgaggccagcgacgtgggc
agcattactcttgccctgcgaactctcggcagctttgagtttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacgccctccgtccacctcatcagcggccac
gcgcacgtcgttagccagactgcggtgcaagtggtggcagacgtgctcagcaaactgctg
gtggtcgggatcacagatcctgaccccgacatccgctactgcgtcttggcatctctggat
gagcgctttgatgcacacctggcccaggcagagaacttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagttggccatctgcacggtgggccggctcagtagc
atgaacccggccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagcggcatcgggagaatcaaagaacagagtgcccgcatgctgggccacttg
gtctccaatgccccccggctcatccgcccctacatggagcccattctgaaggctttaata
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggcc
acaataggagagttggctcaggtcagtggcctagaaatgaggaaatgggttgatgaactc
tttattatcatcatggacatgctccaggactcctccctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccccactttgcttgaggtcctgctgaattttctgaagactgagcagaaccagggtaca
cggagagaggctatccgtgtgttagggcttttgggggccctggatccctacaagcacaaa
gtgaacattggcatgattgaccagtcccgcgacgcttctgctgttagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagcgagatgctggtcaacatgggcaac
ctgcccctggatgagttctaccccgccgtgtccatggtggcgctgatgcggatcttccgg
gaccagtccctctcgcaccatcacaccatggtagtccaggccatcaccttcatcttcaag
tccctgggcctcaagtgtgtgcagttcctgccccaggtcatgcccacgttcctcaacgtc
attcgagtctgtgacggggccatccgggagtttctgttccagcagctggggatgctggtg
tcctttgtgaagagccacatcagaccttacatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcgatccagagcacgatcattcttctcattgagcaaatcgtg
gtagctcttgggggcgaatttaagctctatctgcctcagctgatcccacacatgctacgt
gtcttcatgcatgacaacagcccaggccgcatcgtctccatcaagctgctggctgccatc
cagctgttcggcgccaacctggacgactatttgcacttgctgttgcctcctatcgtgaag
ctgtttgatgcccctgaagtccccctgccgtcccgcaaggcagcgttagagacagtagac
cgcctcacagagtccttggacttcactgactacgcctcccggatcattcacccgatcgtt
cgaaccctggaccagagcccggaactgcgtcccacggccatggacacgttgtcttcgctt
gtctttcagctggggaagaagtaccagattttcattccaatggtgaataaagtcctggta
cgacaccgaatcaaccatcagcgctatgacgtcctcatctgcagaatcgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgaggagtggc
caaggagatgcgttggccagtgggccggtagaaacaggacccatgaagaaactgcatgtc
agcaccatcaaccttcaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ctagaatggctgaggcggctgagtctggagctcctgaaggactcgtcttcaccttccctg
cgctcgtgctgggccctggctcaggcctacaacccgatggccagggatcttttcaacgcc
gcgtttgtgtcctgctggtctgaactgaacgaagaccagcaggatgaactcatcaggagc
atcgagctggccctcacctcgcaggacatcgccgaagtcacgcaaactctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagacgacaacggcatc
gtcctgctgggcgagagggccgccaagtgccgagcatatgccaaagcactacactacaaa
gagctggagttccagaaaggtcccacccctgccatcctagagtctctcatcagcattaat
aataagctacaacagccagaggcagctgccggggtattagaatatgccatgaaacacttc
ggagagctggagatccaggccacctggtacgagaagctgcacgagtgggaagatgcgctc
gtggcctacgacaagaagatggacaccaacaaggatgacccagagctcatgctgggtcgc
atgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgctgtgagaag
tggaccctggttaacgatgagacccaagccaagatggcccggatggccgctgcagctgcc
tggggcttaggtcagtgggacagcatggaggaatatacgtgtatgatccctcgggacacc
cacgatggggcattttatagagccgtgctggcactgcatcaggacctcttctccttggcg
caacagtgtatcgacaaagccagggacctgctggatgcagagctaaccgctatggcagga
gagagctacagtcgggcatatggggccatggtttcttgccacatgctctccgagctggag
gaggttatccagtacaaactcgtccccgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgcatcgtggaggactggcagaaaatcctgatggtgcgc
tccctcgtggtcagcccccacgaggacatgaggacctggctcaagtatgccagcctgtgt
ggcaagagtggcaggctggctcttgctcataagaccttggtgttgctcctgggagttgat
ccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctacgcctac
atgaaaaacatgtggaagagtgctcgcaagatcgatgccttccagcacatgcagcacttc
gtgcagaccatgcagcagcaagcccagcacgccatcgccagcgaggaccagcaacacaag
caggagctgcacaagctcatggccaggtgtttcctgaaactcggggagtggcagctgaac
ctgcagggcatcaatgagagcaccatccccaaagtgctgcagtactacagcgccgccacg
gagcacgaccgcggctggtacaaggcctggcacgcgtgggcagtgatgaacttcgaagct
gtgctgcactacaaacatcagaaccaagcccgcgacgagaagaagaagctgcgtcacgcc
agcggggccaacgtcaccagcacgaccaccgccgccaccacagcggccaccgccaccgcc
acggccaccagcaccgagggcagcaacagcgagagtgaggccgagagcaccgagaacagc
cccaccccgtcccctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatg
tacaccgtccctgccgtccagggcttcttccgttctatctccttgtcgcgaggcaacaac
ctccaggacacgctgagggtcctcaccctgtggtttgattacggtcactggccggacgta
aacgaagccttggtggagggggtgaaggcgatccagattgacacgtggttacaggtcata
cctcagctcattgcaagaattgatacgcccaggcccctggtgggacgcctcatccaccag
cttctcaccgacattggccggtaccacccgcaggccctcatctatcccctgaccgtggcc
tccaagtccaccaccacggcccgccacaacgcagccaacaagattctgaagaacatgtgt
gagcacagtaacaccctggtccagcaggccatgatggtgagtgaggaactgatccgcgtg
gccatcctctggcacgagatgtggcacgaaggcctggaagaagcgtctcgtttatacttt
ggggagaggaacgtgaaaggcatgtttgaggtgttggagcccctgcatgctatgatggaa
cggggcccccagactctgaaggaaacgtcttttaatcaggcatatgggcgagacttaatg
gaggcccaagagtggtgcaggaagtacatgaaatcgggaaacgtgaaggacctcactcaa
gcctgggacctctactatcacgtgttcagacgaatctcaaagcagctgcctcagctcaca
tccttagaactgcagtatgtttcccccaaacttctgatgtgccgggaccttgaattggcc
gtgccgggaacatacgatccccaccagccgatcatccgcattcagtccatagcgccgtct
ctacaggtcatcacctccaagcagcggccccggaagttgaccctcatgggcagcaacggg
catgagtttgttttcctcctgaagggccacgaggacctgcggcaggacgagcgagtgatg
cagctcttcggcctggtgaacaccctcctggccaacgaccccacgtctcttcgcaagaac
ctcagcatccagagatacgccgtcatccccttatcaaccaactcgggcctcatcggctgg
gtcccccactgcgacacgctgcacgccctcatccgggactacagagagaaaaagaagatc
cttctcaacatcgagcatcgcatcatgttgcggatggctccggactacgaccatctgacg
ctgatgcagaaggtggaggtgttcgagcacgccgtcaataacacggccggggatgacctg
gccaagctgctatggctgaaaagccccagctccgaggtgtggtttgaccgaagaaccaac
tacacccgctctttagcggtcatgtccatggtcgggtatattttgggcctgggagataga
cacccatccaacttaatgctggaccggctgagcgggaagatcctgcacattgacttcggg
gactgctttgaggttgctatgaccagggagaaattcccagagaagattccatttagacta
accagaatgctgaccaatgctatggaggttactggtctggatggcaactatagaatcacg
tgccacacagtgatggaagtgcttcgggaacacaaggatagtgtcatggccgtgctggaa
gcctttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaac
aagcggtcccgaacaaggacagattcctactctgctggccagtcagtagaaattttggac
ggtgtggagcttggggaacccgcgcataagaaaacagggaccacggtgccagagtccatt
cattccttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcag
attatcaaccgggttcgagacaagctcactggtcgggacttttctcatgacgaaaccctg
gatgtccccactcaagttgagctgctgatcaagcaagcaacatcccatgaaaacctgtgc
cagtgctacatcggctggtgtcctttttggtaa

DBGET integrated database retrieval system