KEGG   Felis catus (domestic cat): 101098375Help
Entry
101098375         CDS       T02385                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor isoform X2
  KO
K04135  adrenergic receptor alpha-1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04152  AMPK signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101098375 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    101098375 (ADRA1A)
   04152 AMPK signaling pathway
    101098375 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101098375 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101098375 (ADRA1A)
   04270 Vascular smooth muscle contraction
    101098375 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    101098375 (ADRA1A)
G protein-coupled receptors [BR:fca04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    101098375 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 101098375
NCBI-ProteinID: XP_006930679
Ensembl: ENSFCAG00000023739
Position
B1
AA seq 433 aa AA seqDB search
MVFLSGNASDSSNCTHPQAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APVGGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHALSYTL
HPPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSMPRESARITVSKDQSACT
TARVRSKSFLQDF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctgggaatgcctccgacagttccaactgcacccatccgcaggcacca
gtgaacatatccaaggccattctgctcggggtgatcttggggggcctcatcattttcggt
gtgctgggcaacatcctagtgatcctctccgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgacctcctcctcacctccacggtgctg
cccttctctgccatctttgagatcctgggctactgggcctttggcagggttttctgcaat
atctgggcggcggtggacgtcctgtgctgcaccgcgtccatcatgggactctgcatcatc
tccatcgaccgctacatcggtgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggtctcatggccctgctctgtgtctgggcgctctccctcgtcatctccatcggg
cctctgtttggctggaggcagccggcccctgaagacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggccctgggctccttctacgtgccactgaccatcatc
ctggtcatgtactgccgggtctacgtggtggccaagagggaaagccggggcctcaagtcc
ggcctcaagactgacaagtcggactcggagcaggtgacgctccgcatccatcggaaaaat
gccccggtaggaggcagcggggtgtccagcgccaagaacaagacgcacttctccgtgagg
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcctagtgatgcccattgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagcgttttggctcggatacctaaacagctgc
atcaaccctattatatacccatgctccagtcaagagtttaaaaaggcctttcagaacgtc
ttgagaatccagtgtctccgcagaaagcaatcttccaaacacgccctgagctataccctg
cacccacccagccatgccctggagggccaacacaaggacctggtgcgcattccagtggga
tcgggagagaccttctataagatctccaagacggatggggtctgtgagtggaaatttttc
tcttcgatgccccgtgaatctgccaggattacagtgtccaaagaccaatcagcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggacttttaa

DBGET integrated database retrieval system