KEGG   Felis catus (domestic cat): 101098375Help
Entry
101098375         CDS       T02385                                 

Gene name
ADRA1A
Definition
adrenoceptor alpha 1A
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
fca  Felis catus (domestic cat)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:fca04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:fca04080]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:fca04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:fca04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:fca04970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B1
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPQAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APVGGSGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHALSYTL
HPPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSMPRESARITVSKDQSACT
TARVRSKSFLQVCCCMGPSTPSHGENHQVPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctgggaatgcctccgacagttccaactgcacccatccgcaggcacca
gtgaacatatccaaggccattctgctcggggtgatcttggggggcctcatcattttcggt
gtgctgggcaacatcctagtgatcctctccgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgacctcctcctcacctccacggtgctg
cccttctctgccatctttgagatcctgggctactgggcctttggcagggttttctgcaat
atctgggcggcggtggacgtcctgtgctgcaccgcgtccatcatgggactctgcatcatc
tccatcgaccgctacatcggtgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggtctcatggccctgctctgtgtctgggcgctctccctcgtcatctccatcggg
cctctgtttggctggaggcagccggcccctgaagacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggccctgggctccttctacgtgccactgaccatcatc
ctggtcatgtactgccgggtctacgtggtggccaagagggaaagccggggcctcaagtcc
ggcctcaagactgacaagtcggactcggagcaggtgacgctccgcatccatcggaaaaat
gccccggtaggaggcagcggggtgtccagcgccaagaacaagacgcacttctccgtgagg
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcctagtgatgcccattgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagcgttttggctcggatacctaaacagctgc
atcaaccctattatatacccatgctccagtcaagagtttaaaaaggcctttcagaacgtc
ttgagaatccagtgtctccgcagaaagcaatcttccaaacacgccctgagctataccctg
cacccacccagccatgccctggagggccaacacaaggacctggtgcgcattccagtggga
tcgggagagaccttctataagatctccaagacggatggggtctgtgagtggaaatttttc
tcttcgatgccccgtgaatctgccaggattacagtgtccaaagaccaatcagcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggtgtgctgctgtatggggccctcgacc
cccagccatggagagaaccaccaagttccaaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctag

DBGET integrated database retrieval system