KEGG   Felis catus (domestic cat): 101098481Help
Entry
101098481         CDS       T02385                                 

Gene name
USP16
Definition
ubiquitin specific peptidase 16
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101098481 (USP16)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101098481 (USP16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C2
AA seq 826 aa AA seqDB search
MGKKRTKGKTVPIDDSSESLEPTCRHIRKGLEQGNLKRALLNVEWNICQDCKTDNKVKDK
SEEETEENPSVWLCLKCGHQGCGRDSQEQHALKHYMTPRSEPHCLVLSLDNWSVWCYLCD
DEVQYCSSNRLGQVVDYVRKQAGITTPKSAAKDGNIELENXKLEKESKNEQEREKKENLA
KENPSTNSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDL
ALTEPLEINLEPPGPLTLAMSQFLNEMQETKKGIVTPKELFSQVCKKAVRFKGYQQQDSQ
ELLRYLLDGMRAEEQQRVSKGILKAFGNSTEKLDEELKNKVKDYEKKKSVPSFVDRIFGG
ELTSTIMCDECRTVSLVHESFLDLSLPVLDDQSGKKSINDKNLKKTMEDEDKDSEEEKDN
DSYMKERNDIPSGTSKHLQKKAKKQAKKQAKNQRRQQKIQGKVLHLNDICTIDHPEDNEC
EVEMSLQGEVDVKSNHISEEEITHKEYCVNQKDLNGQEKMIENKTDNQKSTEEVDMRNVN
MDNDLEGLASSPTECPRKLNGAYLTEGSSGEVDISSGFKNLNLNAALRPDEINIEILNES
HSPGTKVYEVVNEDPETAFCTLANREAFHTDECSIQHCLYQFTRNEKLRDANKLLCEVCT
RRQYSGPKANVKGERKHVYTNAKKQMLISLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPE
ILDLAPFCTLKCKNVAEENTRVLYSLYGVVEHSGTMRSGHYTAYAKARAANSHLSNLVLH
GDIPQDFEMQSTKGQWFHISDTHVQAVPTTKVLNSQAYLLFYERVL
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacggacaaagggaaaaactgttccaattgatgattcttctgaatcttta
gaacctacgtgcagacacattagaaaaggattggaacaaggtaatttgaaaagggccttg
ttgaacgtggaatggaatatttgtcaagattgtaagacggacaataaagtaaaagataaa
tctgaagaagaaacagaagaaaacccttcagtttggctatgtcttaaatgtggccatcag
ggctgtggcagagattctcaggagcagcatgcattgaagcactatatgacaccaaggtct
gaacctcattgtctggttcttagtttggacaactggagtgtatggtgttacctatgtgat
gatgaggtccagtattgtagttcaaacagattgggtcaggtggttgattatgttagaaaa
caagctggaattacaactccaaaatcagcagcaaaagatggtaacattgaacttgaaaat
naaaaattagaaaaggagagtaaaaatgaacaagagcgagaaaaaaaggaaaacttggct
aaagaaaatccttccacgaattctgcttcccaaataactgtgaaaggactcagtaatttg
ggaaatacatgtttcttcaatgcagttatgcagaatttgtcacaaacaccagtgctgaga
gaactactaaaagaagtaaaaatgtctggaacaattgtaaaaattgaaccacctgatttg
gcactaactgaacccttagaaataaaccttgagcctccaggccctcttactttagccatg
agccagtttcttaatgagatgcaagagaccaaaaaaggaatcgtgacacctaaagagctc
ttttctcaggtctgtaaaaaagcagtacggtttaaaggctatcagcagcaagacagccag
gagctgcttcgctatttattggatggaatgagagcagaagaacaacaaagagtgagtaaa
ggaattcttaaagcatttggtaattctactgaaaaattggatgaagaactaaaaaataaa
gttaaagattatgaaaagaaaaaatccgtaccaagttttgtggaccgcatctttggtggt
gaactaactagtacaatcatgtgtgatgagtgcagaactgtctctttggttcatgaatct
ttccttgatttgtctctaccagttttagatgatcagagtggtaagaaaagtataaatgat
aaaaatttgaaaaagacgatggaggatgaagataaagacagcgaggaagaaaaagataat
gacagttacatgaaagagaggaatgacattccctcaggaacaagtaagcacttacagaaa
aaagcaaagaagcaagccaaaaagcaagccaagaaccaacgaaggcaacaaaaaattcaa
ggaaaagttcttcatttaaatgatatctgtaccatcgaccatcctgaagataatgaatgt
gaggttgaaatgtcacttcagggagaagtggatgttaaatccaaccatatctcagaagag
gaaatcacacataaagaatattgcgttaatcagaaagatttgaatggccaagaaaaaatg
atagaaaataaaactgacaatcaaaaatccacagaggaagtagatatgagaaatgtcaac
atggataatgatttggagggtctggcctcttctcccactgaatgtcctaggaaattaaat
ggtgcctatctgacagaagggagcagtggagaagtggacatttccagtggtttcaaaaac
cttaacttgaatgctgctcttcgacctgatgaaataaatatagagattctgaatgagagt
cattctcctgggaccaaggtatatgaagttgtaaacgaagatccagaaactgctttctgt
actcttgcaaacagggaagctttccatactgatgaatgttcaatccaacattgtttatat
cagttcacccgaaacgagaaacttcgagatgcaaataaactgctttgtgaagtatgcacc
cggagacagtatagtggaccaaaggcaaacgtaaaaggtgaaaggaaacatgtttatacc
aatgccaaaaagcagatgctaatctctcttgctcctcctgttctcactctccatttaaag
agatttcagcaggctggttttaacctacgcaaagttaacaaacacataaaatttccagaa
atcttagatttggctcctttttgtacccttaaatgtaagaatgtcgccgaagaaaacaca
agggtactttattccttatatggagtcgttgaacacagtggcaccatgaggtcagggcat
tatactgcctatgcaaaggcaagagctgccaacagtcacctctctaatcttgttctccac
ggtgatattccacaagattttgaaatgcagtcaaccaaagggcagtggtttcacatcagt
gacacgcatgtgcaagctgtgccgacaactaaagtcctgaactcacaggcgtacctccta
ttttatgagagagtactataa

DBGET integrated database retrieval system