KEGG   Felis catus (domestic cat): 101098499Help
Entry
101098499         CDS       T02385                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
fca  Felis catus (domestic cat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101098499 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101098499 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    101098499 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101098499 (LAMC3)
   05222 Small cell lung cancer
    101098499 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    101098499 (LAMC3)
   05145 Toxoplasmosis
    101098499 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 1551 aa AA seqDB search
MMRGERGQSRSVANVATWWWFLGEREQLRVTLRQETLEKQEATSYLTDFHSQDDSTWWQS
PSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRTHAGSPWEPYQYYSA
SCQRTYGRPEGHYLRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVL
QEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCQCHGHASECGPEEA
GRLACRCQHNTTGVDCERCLPFFQDRPWARGTAEAANECVPCNCSGHSEECVFDRDLFRG
TGHGGRCLRCRDHTAGPHCERCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDDSGTCACKA
TVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLGTCDPHSGRCPCKENVEGKQCDRCRPG
TFNLQPHNPAGCSSCFCFGHSKVCSAAAQFREHHILSDLHQGAEGWRAGSVGGPEHPAQW
SPRGLLLNPEGEEELTLPEKFLGDQRFSYGQPITLTFWVPRGGSPLPVRLRLEGAGLALT
LRPSSLSGPQDAGQPGEAQLTFQLQETSEDAAPPLPPFHFQQLLANLTALRIRAGGQSAS
PSETSEGQRSRTLAEGRGTGQVFLTEVRLTSAQRGLSPPASWVETCSCPKGYTGQFCESC
APGYKRETPLGGPYTSCVPCTCNQHGTCDPHTGICLCGHHTEGPSCERCLPGFYGSPFGG
RADDCQPCPCPGQSACTAIPESREVVCTHCPPGQRGRRCEICDDGYFGDPLGLSGAPQPC
RRCQCSGNVDPNAVGNCDPQSGRCLRCLHNTTGAHCERCEEGFYGSALAPRPADKCTPCS
CYPGGSVSEQRPCDPASGQCTCLPHVTGRDCSQCSPGFYDLRPGRGCRSCKCHPLGSQED
RCHPKTGQCPCRPGVEGQACNRCQLGFFGFSIKGCRACRCSPVGAASAQCHENGTCLCRP
GFVGYKCEHCQENFFITAGGTHCQECPSCYALVKEEASKLKARLTLMEGWLQGSDCSEPW
GPLHALQGEAPRGDVYQGRLLQGAREAFLEQVTGLEGAVKAAREQLRTLSRSVHCARAGT
EKTCIQLADLDAVLESSEEEILQAALVLRSLVIPQEGSSQPTTWSHLATEARALARSHRD
TTAKIEATARRALVASNTSYALLWSLVEGRVALEAQQELEDRYQEVQAAQKALGTAAAEV
LPEAGRALAAAQQADADAALRPASLAAPAALPIISLQKSEAGALGLKAQALEKTVASREH
VVTEAAGVLQATAQAMLRKTEPLTQLRQQARAALTRASSSVQAATVTVTGARTLLADLEG
MKQQFPSPKDRATLGRKAGVVRGRLLPDLKKKTKQAERMLGNAASVSSSAKKKGREAKTL
AEDSAKLARALLRDGKQEHRRAGRLSSQAQATLRQASRQVLASQTRRQELEEAEQVGAGL
RAVERQIWESRTSLEEDVQALLELLARLGSLDTHQAPARALNETQWALERLRLRLSPPGA
LQGKLRLLEQESKQQELQIQSFENDLAEIRADKRNLEAILQSLPKSCASWR
NT seq 4656 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggggcgagaggggccagtcccgtagtgtggccaatgtcgccacctggtggtgg
ttcctgggagaacgtgagcagctgcgtgtgacgctcaggcaggagacactggaaaagcag
gaggcaacctcctacctcaccgacttccacagccaggacgacagcacctggtggcagagc
ccgtccatggccttcggcgtacagtaccccacctcggtcaacatcaccctccgtctgggg
aaagcctacgagatcacctacgtgaggctgaagttccacaccagtcgccccgagagcttt
gccatctacaagcgcacccacgcgggcagcccgtgggaaccctaccagtactacagtgcc
tcctgccaaagaacctacggcaggcccgagggccactacctgcgccccggtgaggacgag
cgcgtggccttctgcacctccgagttcagcgacatctccccgctgagcgggggcaacgtg
gccttctccaccctggagggccggcccagtgcttacaacttcgaggagagccccgtgttg
caggagtgggtcaccagcaccgagctgctcatctccctggaccggctcaacacgttcggg
gatgacatcttcaaggaccccaaggtgttgcagtcctactactatgccgtgtctgacttc
tccgtgggcggcaggtgccagtgccacggacatgccagcgagtgcgggcccgaggaggcg
ggccggctggcctgcagatgccagcacaacaccaccggcgtcgactgcgagcgctgtctg
cccttcttccaggaccgcccgtgggcccggggcaccgctgaggccgccaacgagtgtgtg
ccttgcaattgcagcggccactctgaggagtgtgtgttcgaccgggacctcttccgcggt
acgggccacggcggccgctgcctgcgctgccgggaccacacggccgggccacactgcgag
cgctgccaggaggacttctatcgctggagcccccggacgccgtgccagccctgtgactgc
cacccggcaggttcgctacgtctccagtgcgatgactcaggcacctgtgcctgcaaggcc
accgtcacaggctggaagtgtgaccgctgcctgcccgggttccactcactcagtgaggga
ggctgccgaccctgcacctgcaatcctgctggcagcctgggcacctgtgacccgcacagt
ggacgctgcccctgcaaggagaacgtggaaggcaagcagtgtgacagatgccgtccaggg
acgttcaacctgcagccccataacccagccggctgcagcagctgtttctgctttggccac
tccaaggtgtgctcggccgctgcccagtttcgggagcaccacatcctctccgacctccac
cagggagccgagggctggcgggccggaagtgtggggggcccagagcatcccgcgcagtgg
agcccaagggggctgctcctgaatccagaaggcgaggaggagctcacactaccagagaaa
ttcctgggagaccagcggttcagctacggacagcccatcacactgaccttctgggtcccc
cgcgggggctccccactccccgtgcggctgaggctggaaggggcgggcctggccctgact
ctacgaccctccagcctgtcgggcccccaggatgctgggcagccgggggaggcccagctc
acgttccagttgcaggagacctctgaggacgcggcccctccgctgccccccttccacttc
cagcagctgctcgccaatctgacggctctgcgcatccgggccggcggccagagcgcaagc
ccttccgagacgtctgaaggtcagagaagtaggacactggctgaaggtcgtggaactggc
caggtgttcctgactgaggtccggctcacgtcagcccagcgggggctctccccaccagcc
tcctgggtagagacttgctcatgtcccaaagggtacacaggccagttctgtgaatcctgc
gctccaggatacaagagggagacaccactggggggtccctataccagctgtgtcccctgc
acctgcaaccagcatggcacctgtgacccccacacagggatctgcctgtgtggtcaccac
accgagggcccgtcctgtgagcgctgtttgccaggtttctatggcagccccttcggaggc
cgagccgatgactgtcagccttgtccgtgccctggacagtcggcctgcacagccatccca
gagagcagggaggtagtgtgcacccactgccccccgggccagagagggcgtcgctgtgag
atctgtgatgacggctattttggggaccctctggggctctctggggccccccagccctgc
cggcggtgccagtgcagtgggaacgtagaccccaacgccgtgggcaactgtgacccccag
tctggccgctgcctgcgttgcctgcacaacacgacaggtgcccactgtgagcgctgcgag
gaaggcttctacgggagcgccctggcccctcggcccgcagacaaatgcacgccctgcagc
tgctacccggggggctcagtcagtgagcagagaccctgcgacccggcgagcggccagtgc
acctgcctgcctcatgtgacgggacgggactgtagccagtgcagccccggtttctatgac
ctccggcccgggaggggctgccggagctgcaagtgtcacccgctgggctcccaggaggac
cggtgtcaccccaagaccgggcagtgcccctgtcgtccaggcgttgagggccaggcctgc
aacagatgccagctgggtttcttcggcttctccatcaagggatgccgagcctgcaggtgc
tccccggtgggggccgcctcggcacaatgccacgagaacggcacgtgcttgtgcagaccc
ggcttcgtggggtacaagtgtgaacactgtcaggaaaacttcttcatcacggccggtggc
acacactgtcaggagtgcccgtcctgctacgccctggtgaaggaggaggcttccaagctg
aaggccaggctgaccctgatggaggggtggctgcaggggtccgactgtagtgagccctgg
ggaccactacacgctctgcagggagaggccccacggggagacgtctaccagggacgtctg
ctgcaaggagcccgggaagccttcctggagcaggtgacaggcctcgaaggtgctgtgaag
gctgcccgggagcagctgcgtacgctgagcaggagtgtccactgtgcccgggccggaaca
gagaagacctgcatccagctggcggacctagatgcagtgctggagtcttcagaggaggag
attctgcaggcggcccttgtcctcagatctctggtgattcctcaggaagggtccagccag
cccaccacctggagccacctggccaccgaggcccgtgcccttgccaggagccacagggac
accactgccaagattgaggccactgcgcggagggccctggtcgcctccaacaccagttat
gcgcttctctggagtctggtggagggcagagtggccctggaggcccagcaggaactggag
gacaggtaccaggaggtccaggccgcccagaaggcgctgggcacggctgcggcagaggtg
ctgcccgaagctgggagggcgctggccgccgcgcaacaagctgatgcggatgcagccctg
cgcccggcctcgctggccgcccctgcagcactgcccatcatctccctgcagaagtccgag
gccggggccctgggtctgaaggcacaggccctggagaagacagttgcatctagagagcat
gtggtcaccgaggctgccggggtcctccaggccaccgcccaggccatgctgcggaagacc
gagcccctcacacagctacgccagcaggccagagccgccctgacccgggcttcctcatcc
gtccaggctgccacggtgactgtcacgggagccaggaccctgctggccgacctggaggga
atgaagcagcagtttccttcgcccaaggaccgggccacgctggggaggaaggcaggcgtg
gtcaggggcaggctccttccagacttgaaaaagaagaccaagcaggcggagaggatgctg
ggaaatgcggcgtctgtctcctccagtgccaagaagaagggccgtgaagccaagacgttg
gctgaggacagtgctaagctcgccagggccttgctgagggacgggaagcaggagcatcgc
cgggcaggccggctgtccagccaggcgcaggcgacgctccgacaggcctcgcggcaggtg
ctagcctcacaaacccgccgacaggagctggaggaagctgagcaggtgggtgccgggctg
cgtgccgtggagcggcagatctgggaatcgcgcacgtccctggaagaggacgtccaggcc
ttgttggagctacttgccaggctggggtcactggacacccaccaagccccagcccgggcc
ctgaacgagacccagtgggcactggagcgcctgaggctgcggctgagcccgccgggggcc
ctgcaggggaaactgaggctgttggagcaggagtccaagcagcaggagctgcagatccag
agcttcgagaacgacctcgcggagatccgtgccgacaagcggaacctggaggccattctg
cagagcctgcccaagagctgtgccagctggcggtga

DBGET integrated database retrieval system