KEGG   Felis catus (domestic cat): 101098499Help
Entry
101098499         CDS       T02385                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
fca  Felis catus (domestic cat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:fca04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:fca04510]
Human Diseases; Cancers; Pathways in cancer [PATH:fca05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:fca05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:fca05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:fca05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 1540 aa AA seqDB search
MMRGERGQSRSVANVATWWWFLGEREQLRVTLRQETLEKQEAXXXXXXXSYLTDFHSQDD
STWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRTHAGSPWEP
YQYYSASCQRTYGRPEGHYLRPGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNF
EESPVLQEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCQCHGHASE
CGPEEAGRLACRCQHNTTGVDCERCLPFFQDRPWARGTAEAANECVPCNCSGHSEECVFD
RDLFRGTGHGGRCLRCRDHTAGPHCERCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDDSG
TCACKATVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLGTCDPHSGRCPCKENVEGKQC
DRCRPGTFNLQPHNPAGCSSCFCFGHSKVCSAAAQFREHHILSDLHQGAEGWRAGSVGGP
EHPAQWSPRGLLLNPEGEEELTLPEKFLGDQRFSYGQPITLTFWVPRGGSPLPVRLRLEG
AGLALTLRPSSLSGPQDAGQPGEAQLTFQLQETSEDAAPPLPPFHFQQLLANLTALRIRA
GGQSASPSGQVFLTEVRLTSAQRGLSPPASWVETCSCPKGYTGQFCESCAPGYKRETPLG
GPYTSCVPCTCNQHGTCDPHTGICLCGHHTEGPSCERCLPGFYGSPFGGRADDCQPCPCP
GQSACTAIPESREVVCTHCPPGQRGRRCEICDDGYFGDPLGLSGAPQPCRRCQCSGNVDP
NAVGNCDPQSGRCLRCLHNTTGAHCERCEEGFYGSALAPRPADKCTPCSCYPGGSVSEQR
PCDPASGQCTCLPHVTGRDCSQCSPGFYDLRPGRGCRSCKCHPLGSQEDRCHPKTGQCPC
RPGVEGQACNRCQLGFFGFSIKGCRACRCSPVGAASAQCHENGTCLCRPGFVGYKCEHCQ
ENFFITAGGTHCQECPSCYALVKEEASKLKARLTLMEGWLQGSDCSEPWGPLHALQGEAP
RGDVYQGRLLQGAREAFLEQVTGLEGAVKAAREQLRTLSRSVHCARAGTEKTCIQLADLD
AVLESSEEEILQAALVLRSLVIPQEGSSQPTTWSHLATEARALARSHRDTTAKIEATARR
ALVASNTSYALLWSLVEGRVALEAQQELEDRYQEVQAAQKALGTAAAEVLPEAGRALAAA
QQADADAALRPASLAAPAALPIISLQKSEAGALGLKAQALEKTVASREHVVTEAAGVLQA
TAQAMLRKTEPLTQLRQQARAALTRASSSVQAATVTVTGARTLLADLEGMKQQFPSPKDR
ATLGRKAGVVRGRLLPDLKKKTKQAERMLGNAASVSSSAKKKGREAKTLAEDSAKLARAL
LRDGKQEHRRAGRLSSQAQATLRQASRQVLASQTRRQELEEAEQVGAGLRAVERQIWESR
TSLEEDVQALLELLARLGSLDTHQAPARALNETQWALERLRLRLSPPGALQGKLRLLEQE
SKQQELQIQSFENDLAEIRADKRNLEAILQSLPKSCASWR
NT seq 4623 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggggcgagaggggccagtcccgtagtgtggccaatgtcgccacctggtggtgg
ttcctgggagaacgtgagcagctgcgtgtgacgctcaggcaggagacactggaaaagcag
gaggcaannnnnnnnnnnnnnnnnncctcctacctcaccgacttccacagccaggacgac
agcacctggtggcagagcccgtccatggccttcggcgtacagtaccccacctcggtcaac
atcaccctccgtctggggaaagcctacgagatcacctacgtgaggctgaagttccacacc
agtcgccccgagagctttgccatctacaagcgcacccacgcgggcagcccgtgggaaccc
taccagtactacagtgcctcctgccaaagaacctacggcaggcccgagggccactacctg
cgccccggtgaggacgagcgcgtggccttctgcacctccgagttcagcgacatctccccg
ctgagcgggggcaacgtggccttctccaccctggagggccggcccagtgcttacaacttc
gaggagagccccgtgttgcaggagtgggtcaccagcaccgagctgctcatctccctggac
cggctcaacacgttcggggatgacatcttcaaggaccccaaggtgttgcagtcctactac
tatgccgtgtctgacttctccgtgggcggcaggtgccagtgccacggacatgccagcgag
tgcgggcccgaggaggcgggccggctggcctgcagatgccagcacaacaccaccggcgtc
gactgcgagcgctgtctgcccttcttccaggaccgcccgtgggcccggggcaccgctgag
gccgccaacgagtgtgtgccttgcaattgcagcggccactctgaggagtgtgtgttcgac
cgggacctcttccgcggtacgggccacggcggccgctgcctgcgctgccgggaccacacg
gccgggccacactgcgagcgctgccaggaggacttctatcgctggagcccccggacgccg
tgccagccctgtgactgccacccggcaggttcgctacgtctccagtgcgatgactcaggc
acctgtgcctgcaaggccaccgtcacaggctggaagtgtgaccgctgcctgcccgggttc
cactcactcagtgagggaggctgccgaccctgcacctgcaatcctgctggcagcctgggc
acctgtgacccgcacagtggacgctgcccctgcaaggagaacgtggaaggcaagcagtgt
gacagatgccgtccagggacgttcaacctgcagccccataacccagccggctgcagcagc
tgtttctgctttggccactccaaggtgtgctcggccgctgcccagtttcgggagcaccac
atcctctccgacctccaccagggagccgagggctggcgggccggaagtgtggggggccca
gagcatcccgcgcagtggagcccaagggggctgctcctgaatccagaaggcgaggaggag
ctcacactaccagagaaattcctgggagaccagcggttcagctacggacagcccatcaca
ctgaccttctgggtcccccgcgggggctccccactccccgtgcggctgaggctggaaggg
gcgggcctggccctgactctacgaccctccagcctgtcgggcccccaggatgctgggcag
ccgggggaggcccagctcacgttccagttgcaggagacctctgaggacgcggcccctccg
ctgccccccttccacttccagcagctgctcgccaatctgacggctctgcgcatccgggcc
ggcggccagagcgcaagcccttccggccaggtgttcctgactgaggtccggctcacgtca
gcccagcgggggctctccccaccagcctcctgggtagagacttgctcatgtcccaaaggg
tacacaggccagttctgtgaatcctgcgctccaggatacaagagggagacaccactgggg
ggtccctataccagctgtgtcccctgcacctgcaaccagcatggcacctgtgacccccac
acagggatctgcctgtgtggtcaccacaccgagggcccgtcctgtgagcgctgtttgcca
ggtttctatggcagccccttcggaggccgagccgatgactgtcagccttgtccgtgccct
ggacagtcggcctgcacagccatcccagagagcagggaggtagtgtgcacccactgcccc
ccgggccagagagggcgtcgctgtgagatctgtgatgacggctattttggggaccctctg
gggctctctggggccccccagccctgccggcggtgccagtgcagtgggaacgtagacccc
aacgccgtgggcaactgtgacccccagtctggccgctgcctgcgttgcctgcacaacacg
acaggtgcccactgtgagcgctgcgaggaaggcttctacgggagcgccctggcccctcgg
cccgcagacaaatgcacgccctgcagctgctacccggggggctcagtcagtgagcagaga
ccctgcgacccggcgagcggccagtgcacctgcctgcctcatgtgacgggacgggactgt
agccagtgcagccccggtttctatgacctccggcccgggaggggctgccggagctgcaag
tgtcacccgctgggctcccaggaggaccggtgtcaccccaagaccgggcagtgcccctgt
cgtccaggcgttgagggccaggcctgcaacagatgccagctgggtttcttcggcttctcc
atcaagggatgccgagcctgcaggtgctccccggtgggggccgcctcggcacaatgccac
gagaacggcacgtgcttgtgcagacccggcttcgtggggtacaagtgtgaacactgtcag
gaaaacttcttcatcacggccggtggcacacactgtcaggagtgcccgtcctgctacgcc
ctggtgaaggaggaggcttccaagctgaaggccaggctgaccctgatggaggggtggctg
caggggtccgactgtagtgagccctggggaccactacacgctctgcagggagaggcccca
cggggagacgtctaccagggacgtctgctgcaaggagcccgggaagccttcctggagcag
gtgacaggcctcgaaggtgctgtgaaggctgcccgggagcagctgcgtacgctgagcagg
agtgtccactgtgcccgggccggaacagagaagacctgcatccagctggcggacctagat
gcagtgctggagtcttcagaggaggagattctgcaggcggcccttgtcctcagatctctg
gtgattcctcaggaagggtccagccagcccaccacctggagccacctggccaccgaggcc
cgtgcccttgccaggagccacagggacaccactgccaagattgaggccactgcgcggagg
gccctggtcgcctccaacaccagttatgcgcttctctggagtctggtggagggcagagtg
gccctggaggcccagcaggaactggaggacaggtaccaggaggtccaggccgcccagaag
gcgctgggcacggctgcggcagaggtgctgcccgaagctgggagggcgctggccgccgcg
caacaagctgatgcggatgcagccctgcgcccggcctcgctggccgcccctgcagcactg
cccatcatctccctgcagaagtccgaggccggggccctgggtctgaaggcacaggccctg
gagaagacagttgcatctagagagcatgtggtcaccgaggctgccggggtcctccaggcc
accgcccaggccatgctgcggaagaccgagcccctcacacagctacgccagcaggccaga
gccgccctgacccgggcttcctcatccgtccaggctgccacggtgactgtcacgggagcc
aggaccctgctggccgacctggagggaatgaagcagcagtttccttcgcccaaggaccgg
gccacgctggggaggaaggcaggcgtggtcaggggcaggctccttccagacttgaaaaag
aagaccaagcaggcggagaggatgctgggaaatgcggcgtctgtctcctccagtgccaag
aagaagggccgtgaagccaagacgttggctgaggacagtgctaagctcgccagggccttg
ctgagggacgggaagcaggagcatcgccgggcaggccggctgtccagccaggcgcaggcg
acgctccgacaggcctcgcggcaggtgctagcctcacaaacccgccgacaggagctggag
gaagctgagcaggtgggtgccgggctgcgtgccgtggagcggcagatctgggaatcgcgc
acgtccctggaagaggacgtccaggccttgttggagctacttgccaggctggggtcactg
gacacccaccaagccccagcccgggccctgaacgagacccagtgggcactggagcgcctg
aggctgcggctgagcccgccgggggccctgcaggggaaactgaggctgttggagcaggag
tccaagcagcaggagctgcagatccagagcttcgagaacgacctcgcggagatccgtgcc
gacaagcggaacctggaggccattctgcagagcctgcccaagagctgtgccagctggcgg
tga

DBGET integrated database retrieval system