KEGG   Felis catus (domestic cat): 101098499Help
Entry
101098499         CDS       T02385                                 

Gene name
LAMC3
Definition
(RefSeq) LOW QUALITY PROTEIN: laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05145  Toxoplasmosis
fca05146  Amoebiasis
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101098499 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101098499 (LAMC3)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101098499 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101098499 (LAMC3)
   05222 Small cell lung cancer
    101098499 (LAMC3)
  Infectious diseases
   05165 Human papillomavirus infection
    101098499 (LAMC3)
   05146 Amoebiasis
    101098499 (LAMC3)
   05145 Toxoplasmosis
    101098499 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Motif
Other DBs
NCBI-GeneID: 101098499
NCBI-ProteinID: XP_023098628
Ensembl: ENSFCAG00000005118
Position
D4
AA seq 1590 aa AA seqDB search
MAAAAVLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRRAEASHTCGRPPED
FCPHVGAPGAGAQCQRCDADDPQLHHDASYLTDFHSQDDSTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRTHAGSPWEPYQYYSASCQRTYGRPEGHYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPVLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCQCHGHASECGPEEAGRLACRCQHNTTGVD
CERCLPFFQDRPWARGTAEAANECVPCNCSGHSEECVFDRDLFRGTGHGGRCLRCRDHTA
GPHCERCQEDFYRWSPRTPCQPCDCHPAGSLRLQCDDSGTCACKATVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLGTCDPHSGRCPCKENVEGKQCDRCRPGTFNLQPHNPAGCSSC
FCFGHSKVCSAAAQFREHHILSDLHQGAEGWRAGSVGGPEHPAQWSPRGLLLNPEGEEEL
TLPEKFLGDQRFSYGQPITLTFWVPRGGSPLPVRLRLEGAGLALTLRPSSLSGPQDAGQP
GEAQLTFQLQETSEDAAPPLPPFHFQQLLANLTALRIRAGGQSASPSETSEGQRSRTLAE
GRGTGQVFLTEVRLTSAQRGLSPPASWVETCSCPKGYTGQFCESCAPGYKRETPLGGPYT
SCVPCTCNQHGTCDPHTGICLCGHHTEGPSCERCLPGFYGSPFGGRADDCQPCPCPGQSA
CTAIPESREVVCTHCPPGQRGRRCEICDDGXFGDPLGLSGAPQPCRRCQCSGNVDPNAVG
NCDPQSGRCLRCLHNTTGAHCERCEEGFYGSALAPRPADKCTPCSCYPGGSVSEQRPCDP
ASGQCTCLPHVTGRDCSQCSPGFYDLRPGRGCRSCKCHPLGSQEDRCHPKTGQCPCRPGV
EGQACNRCQLGFFGFSIKGCRACRCSPVGAASAQCHENGTCLCRPGFVGYKCEHCQENFF
ITAGGTHCQECPSCYALVKEEASKLKARLTLMEGWLQGSDCSEPWGPLHALQGEAPRGDV
YQGRLLQGAREAFLEQVTGLEGAVKAAREQLRTLSRSVHCARAGTEKTCIQLADLDAVLE
SSEEEILQAALVLRSLVIPQEGSSQPTTWSHLATEARALARSHRDTTAKIEATARRALVA
SNTSYALLWSLVEGRVALEAQQELEDRYQEVQAAQKALGTAAAEVLPEAGRALAAAQQAD
ADAALRPASLAAPAALKSEAGALGLKAQALEKTVASREHVVTEAAGVLQATAQAMLRKTE
PLTQLRQQARAALTRASSSVQAATVTVTGARTLLADLEGMKQQFPSPKDRATLGRKAGVV
RGRLLPDLKKKTKQAERMLGNAASVSSSAKKKGREAKTLAEDSAKLARALLRDGKQEHRR
AGRLSSQAQATLRQASRQVLASQTRRQELEEAEQVGAGLRAVERQIWESRTSLEEDVQAL
LELLARLGSLDTHQAPARALNETQWALERLRLRLSPPGALQGKLRLLEQESKQQELQIQS
FENDLAEIRADKRNLEAILQSLPKSCASWR
NT seq 4773 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcggcggtcctgctgggcctggcgctcctggcgccgcgggcggccggcgcg
ggcatgggcgcgtgttacgacggcgcggggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgttcggccggcgcgccgaggcctcgcacacgtgcggccgcccgcccgaggac
ttctgcccccacgtgggcgcgccgggcgcgggggcgcagtgccagcgctgcgacgccgac
gacccccagcttcaccacgacgcctcctacctcaccgacttccacagccaggacgacagc
acctggtggcagagcccgtccatggccttcggcgtacagtaccccacctcggtcaacatc
accctccgtctggggaaagcctacgagatcacctacgtgaggctgaagttccacaccagt
cgccccgagagctttgccatctacaagcgcacccacgcgggcagcccgtgggaaccctac
cagtactacagtgcctcctgccaaagaacctacggcaggcccgagggccactacctgcgc
cccggtgaggacgagcgcgtggccttctgcacctccgagttcagcgacatctccccgctg
agcgggggcaacgtggccttctccaccctggagggccggcccagtgcttacaacttcgag
gagagccccgtgttgcaggagtgggtcaccagcaccgagctgctcatctccctggaccgg
ctcaacacgttcggggatgacatcttcaaggaccccaaggtgttgcagtcctactactat
gccgtgtctgacttctccgtgggcggcaggtgccagtgccacggacatgccagcgagtgc
gggcccgaggaggcgggccggctggcctgcagatgccagcacaacaccaccggcgtcgac
tgcgagcgctgtctgcccttcttccaggaccgcccgtgggcccggggcaccgctgaggcc
gccaacgagtgtgtgccttgcaattgcagcggccactctgaggagtgtgtgttcgaccgg
gacctcttccgcggtacgggccacggcggccgctgcctgcgctgccgggaccacacggcc
gggccacactgcgagcgctgccaggaggacttctatcgctggagcccccggacgccgtgc
cagccctgtgactgccacccggcaggttcgctacgtctccagtgcgatgactcaggcacc
tgtgcctgcaaggccaccgtcacaggctggaagtgtgaccgctgcctgcccgggttccac
tcactcagtgagggaggctgccgaccctgcacctgcaatcctgctggcagcctgggcacc
tgtgacccgcacagtggacgctgcccctgcaaggagaacgtggaaggcaagcagtgtgac
agatgccgtccagggacgttcaacctgcagccccataacccagccggctgcagcagctgt
ttctgctttggccactccaaggtgtgctcggccgctgcccagtttcgggagcaccacatc
ctctccgacctccaccagggagccgagggctggcgggccggaagtgtggggggcccagag
catcccgcgcagtggagcccaagggggctgctcctgaatccagaaggcgaggaggagctc
acactaccagagaaattcctgggagaccagcggttcagctacggacagcccatcacactg
accttctgggtcccccgcgggggctccccactccccgtgcggctgaggctggaaggggcg
ggcctggccctgactctacgaccctccagcctgtcgggcccccaggatgctgggcagccg
ggggaggcccagctcacgttccagttgcaggagacctctgaggacgcggcccctccgctg
ccccccttccacttccagcagctgctcgccaatctgacggctctgcgcatccgggccggc
ggccagagcgcaagcccttccgagacgtctgaaggtcagagaagtaggacactggctgaa
ggtcgtggaactggccaggtgttcctgactgaggtccggctcacgtcagcccagcggggg
ctctccccaccagcctcctgggtagagacttgctcatgtcccaaagggtacacaggccag
ttctgtgaatcctgcgctccaggatacaagagggagacaccactggggggtccctatacc
agctgtgtcccctgcacctgcaaccagcatggcacctgtgacccccacacagggatctgc
ctgtgtggtcaccacaccgagggcccgtcctgtgagcgctgtttgccaggtttctatggc
agccccttcggaggccgagccgatgactgtcagccttgtccgtgccctggacagtcggcc
tgcacagccatcccagagagcagggaggtagtgtgcacccactgccccccgggccagaga
gggcgtcgctgtgagatctgtgatgacggcntatttggggaccctctggggctctctggg
gccccccagccctgccggcggtgccagtgcagtgggaacgtagaccccaacgccgtgggc
aactgtgacccccagtctggccgctgcctgcgttgcctgcacaacacgacaggtgcccac
tgtgagcgctgcgaggaaggcttctacgggagcgccctggcccctcggcccgcagacaaa
tgcacgccctgcagctgctacccggggggctcagtcagtgagcagagaccctgcgacccg
gcgagcggccagtgcacctgcctgcctcatgtgacgggacgggactgtagccagtgcagc
cccggtttctatgacctccggcccgggaggggctgccggagctgcaagtgtcacccgctg
ggctcccaggaggaccggtgtcaccccaagaccgggcagtgcccctgtcgtccaggcgtt
gagggccaggcctgcaacagatgccagctgggtttcttcggcttctccatcaagggatgc
cgagcctgcaggtgctccccggtgggggccgcctcggcacaatgccacgagaacggcacg
tgcttgtgcagacccggcttcgtggggtacaagtgtgaacactgtcaggaaaacttcttc
atcacggccggtggcacacactgtcaggagtgcccgtcctgctacgccctggtgaaggag
gaggcttccaagctgaaggccaggctgaccctgatggaggggtggctgcaggggtccgac
tgtagtgagccctggggaccactacacgctctgcagggagaggccccacggggagacgtc
taccagggacgtctgctgcaaggagcccgggaagccttcctggagcaggtgacaggcctc
gaaggtgctgtgaaggctgcccgggagcagctgcgtacgctgagcaggagtgtccactgt
gcccgggccggaacagagaagacctgcatccagctggcggacctagatgcagtgctggag
tcttcagaggaggagattctgcaggcggcccttgtcctcagatctctggtgattcctcag
gaagggtccagccagcccaccacctggagccacctggccaccgaggcccgtgcccttgcc
aggagccacagggacaccactgccaagattgaggccactgcgcggagggccctggtcgcc
tccaacaccagttatgcgcttctctggagtctggtggagggcagagtggccctggaggcc
cagcaggaactggaggacaggtaccaggaggtccaggccgcccagaaggcgctgggcacg
gctgcggcagaggtgctgcccgaagctgggagggcgctggccgccgcgcaacaagctgat
gcggatgcagccctgcgcccggcctcgctggccgcccctgcagcactgaagtccgaggcc
ggggccctgggtctgaaggcacaggccctggagaagacagttgcatctagagagcatgtg
gtcaccgaggctgccggggtcctccaggccaccgcccaggccatgctgcggaagaccgag
cccctcacacagctacgccagcaggccagagccgccctgacccgggcttcctcatccgtc
caggctgccacggtgactgtcacgggagccaggaccctgctggccgacctggagggaatg
aagcagcagtttccttcgcccaaggaccgggccacgctggggaggaaggcaggcgtggtc
aggggcaggctccttccagacttgaaaaagaagaccaagcaggcggagaggatgctggga
aatgcggcgtctgtctcctccagtgccaagaagaagggccgtgaagccaagacgttggct
gaggacagtgctaagctcgccagggccttgctgagggacgggaagcaggagcatcgccgg
gcaggccggctgtccagccaggcgcaggcgacgctccgacaggcctcgcggcaggtgcta
gcctcacaaacccgccgacaggagctggaggaagctgagcaggtgggtgccgggctgcgt
gccgtggagcggcagatctgggaatcgcgcacgtccctggaagaggacgtccaggccttg
ttggagctacttgccaggctggggtcactggacacccaccaagccccagcccgggccctg
aacgagacccagtgggcactggagcgcctgaggctgcggctgagcccgccgggggccctg
caggggaaactgaggctgttggagcaggagtccaagcagcaggagctgcagatccagagc
ttcgagaacgacctcgcggagatccgtgccgacaagcggaacctggaggccattctgcag
agcctgcccaagagctgtgccagctggcggtga

DBGET integrated database retrieval system