KEGG   Felis catus (domestic cat): 101098612Help
Entry
101098612         CDS       T02385                                 

Gene name
FLNB
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:fca04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:fca05205]
Human Diseases; Infectious diseases; Salmonella infection [PATH:fca05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETAGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
VQPGPHVVKVSFAGDTIPKSPFVVQVGEACSPNACRASGRGLQPKGIRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGKYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESVGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPAAGDYNPDLVQAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFSSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFAVGVAAPLDLSKIKINGLENRVEVGK
GQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVVGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLQHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGAKAEVCIENNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRVKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHVANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPVPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYVPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARIL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNIVDNGDGTHTVTYTPSQEGPYMISVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPKRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVEAVEEAPVNACSPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGSHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSEFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEIDSSDMSAHVTSPSGRVTEAEIVSMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGDPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKEKGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaactgagaaggacctggcggaggacgcgccgtggaagaagatccagcagaac
accttcacgcgttggtgcaacgagcacctcaagtgtgtgaacaaacgcatcgggaacctg
cagaccgacctgagcgatgggctgcggctcatcgcgctgctcgaggtgctcagccagaaa
cgcatgtaccgcaagtaccaccagcggcccaccttccgccagatgcagctggagaacgtg
tccgtggccctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcctgggcctggtgtggacactgatcctccac
tactccatctccatgcccgtgtgggaggacgaaggggatgacgatgccaagaagcagacg
ccgaagcagaggctgctgggatggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagatggcaaggctctgggagccttggtagacagctgtgcccca
ggtctgtgtccagactgggaatcctgggatccacgcaagcctgtggacaatgcacgggaa
gctatgcagcaagcagacgactggctgggtgtcccacaggtcatcactcctgaagaaatt
attcaccccgatgtggatgagcactcggtgatgacttacctgtcccagttccccaaagcc
aagctcaagccgggagctcctctgaagcccaaactcaacccgaagaaagccagggcctat
ggccgaggaatcgagcctactggaaacatggtaaagcagccagccaagttcactgtagac
accatcagtgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgactccagacagtgacaagaacaagacatactctgtggagtatttg
cccaaggtcaccgggctgcacaaagttacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcgcagggagatgccagtaaagtcactgccaaa
ggcccaggcttggaaactgctggaaacatcgccaataagcccacctactttgacatctac
acagcaggtgccggtgtgggtgacattggtgttgaagtggaggatccccaggggaagaac
actgtggaattactggtggaagacaaaggaaaccaggtgtatagatgtgtgtacaaacca
gtacagcctggcccccatgtggtcaaggtctcctttgctggggacaccattcccaagagt
cccttcgttgtacaggttggggaagcctgtagtccaaacgcctgccgggccagtggccga
ggcctgcagcccaaaggcatccgcatccgggagactgcagacttcaaggttgataccaaa
gctgctggaagcggagaactcggtgtgactgtgaagggtcctaagggtctggaggagctg
gtgaaacagaaaggctttctggatggagtctatgcatttgagtattaccccagcaccccg
gggaaatacagcattgccatcacgtgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagttcgtgcatggggccctggcctccac
ggtgggattgtcgggcggtcggcagacttcgtggtagagtccgttggctctgaagtgggg
tctttggggtttgccatcgaaggcccctcccaggcaaagattgagtatgatgaccagaat
gatggctcatgtgacgtcaagtactggcccaaggagccgggcgaatatgccgttcacatc
atgtgtgatgatgaggacatcaaggacagcccgtacatggccttcatccatccagctgca
ggagactacaacccagatctggtccaagcttacggaccaggtttggagaaatctggctgc
attgtcaacaacctggctgagttcactgtggatcctaaggatgccggaaaagctccctta
aagatatttgctcaggatggggaaggccagcccattgacatccagatgaagagccgaatg
gacggcacgtatgcctgctcgtacaccccagttaaggccatcaagcacaccattgccgtg
gtctggggaggtgtgaacatccctcacagcccctacagggtcaatatcgggcagggtagt
catccccagaaggtcaaggtgtttgggccaggcgtggagcgaagtggactgaaggcaaat
gagcctactcatttcacagtggactgtaccgaggctggggaaggtgatgtcagcgttggc
attaaatgtgatgcccgggtgttaagtgaggatgaggaagacgtggactttgacattatt
cacaacgccaacgacacgtttacggtcaaatatgtgcctcctgctgccgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtgaaagttgac
ccttcccatgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccaacccacttcactgtctataccaaaggggctggaaaggccccactg
aatgtgcagttcagcagcccccttcctggagacgccgtgaaggatttggacatcatcgac
aattacgactactctcacaccgttaaatacacacccacccagcagggcaatatgcaggtt
ctggttacctatggtggcgaccccatccctaaaagccctttcgccgtgggcgtggctgct
ccactggatctgagcaagataaaaattaatgggctggaaaacagagtcgaagtcgggaag
ggccaggagttcgccattgacacaaacggggcaggaggccaggggaagctggatgtgacg
atcctaagcccctcgaggaaggtcgtgccgtgtctggtggcgcccgtggtgggccgggag
agcagcacagccaagttcatccctcgcgaggaggggctctacgctgtagacgtcacctac
gatggacaccccgtgcctgggagcccctacacggtggaggcctcactgccaccagatccc
accaaggtgaaggcccatggtcctggccttgaaggtggtctcgtgggcaagcccgcggag
ttcaccatcgacaccaaaggagcgggcaccggaggcttgggcctcaccgtggaaggccca
tgtgaggccaaaattgaatgctctgacaatggcgatggcacgtgctctgtctcctacctg
cccacaaagcccggggagtactttgtcaacattctctttgaagaagtccatatacctggt
tctcccttcaaagccgacattgaaatgcctttcgacccctctaaagtcgtggcttcgggg
ccaggtctccagcatgggaaagtgggcgaagctgggctgctgagtgttgactgttcggaa
gcagggcccggggccctgggcctggaagccgtgtcagactcgggagcgaaagccgaagtc
tgtattgaaaacaacaaagacggcacctatgcagtgacctatgtgcccctgaccgccggc
atgtacacactgacgatgaagtatggcggcgagctcgtgccccacttccccgccagggtc
aaggtggagcccgctgtggacaccagcagggtcaaagtctttgggccaggaatagaagga
aaagatgtgtttcgtgaggccaccactgacttcacggtcgactcacggcccctgacacag
gttgggggtgaccacatcaaagcccatgttgccaacccctcaggggcctctaccgagtgc
ttcgtcacagacaatgccgatgggacctaccaggtggagtacacgccctttgagaaaggt
ctccatgtagtggaggtgacctacgatgatgtacctgtcccaaatagtcccttcaaagtg
gctgtaaccgaaggctgccagccatctcgggttcaagcccaaggacctgggttgaaagag
gcctttaccaacaaacccaatgtcttcaccgtggttactagaggggcaggaattggtggg
cttggcataactgtcgaaggcccatcagagtcgaagatcaactgcagagacaacaaagat
ggtagctgcagcgctgagtacgtcccctttgctccaggcgactatgacgttaacatcaca
tatggaggagcccacatccctggcagtcccttcagagttccagtgaaagatgtcgtggat
cctagcaaggtcaagattgctggccccggactgggctccggtgtccgagctcgcatcttg
cagtctttcacagtggacagcagcaaagccggcctggccccactggaagtgagggtcctg
ggcccacgaggcctggtggagccggtgaacatagtggacaatggggatggcacacacaca
gtgacctacaccccatcccaggaggggccttacatgatctcggttaaatacgctgatgaa
gagatccctcgtagtccctttaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccctggcctcagttcctatggtgtgcctgccagtctgcctgtggagttt
gcaatcgatgccagagatgccggggaaggcctgcttgctgttcagataacggaccaagag
ggaaagcccaaaagagccactgtccacgacaataaagatggcacgtatgccgtcacctac
atccctgacaagaccggacgctatatgattggggtcacctatgggggggatgacatccca
ttgtctccctaccgcatccgggccacacagacaggagatgccagcaagtgtctggccaca
ggtcctggaatcgcctccactgtgaaaaccggcgaggaagtgggctttgtggttgatgcc
aagaccgctgggaaggggaaagtgacctgcacggttctgaccccagacggcaccgaggct
gaggccgatgtcattgagaatgaggatggcacctacgacatcttctacacggccgccaag
ccaggcacctatgtgatctatgtgcgctttggcggcgttgatattcccaacagcccattc
actgtcatggccacagatggggaagtcgaggccgtggaggaggcaccggtaaatgcatgt
tcccccggattcaggccctgggtaaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctgggctttaagcctttcgacttggtcattccatttgcagtcagaaaaggagaaatc
accggagaggtccacatgccttctgggaagacggccacgcctgagattgtggacaacaag
gacggcacagtcaccgtcagatacgcccccactgaagtcgggctgcatgagatgcacatc
aaatacatgggcagccacatccctgagagcccgctccagttctacgtgaactacccgaac
agtgggagtgtttctgcatacggtccaggcctggtgtatggagtggccaacaaaactgcc
accttcaccatcgtcaccgaggatgcaggagaagggggcctagacttggctatcgaggga
ccttcaaaggccgaaatcagctgcattgacaacaaagatgggacatgcacagtgacctac
ctgcccaccctgccaggtgactatagcatcctggtcaagtacaatgacaagcacatccct
ggcagccccttcacggccaagatcacagatgacagcagacggtgctctcaggtaaagctg
ggctctgccgccgacttcctgcttgacatcagcgagaccgacctcagcaccctgacggcc
agcattaaggccccatctggccgtgacgagccctgtctcctgaagaggctgcccaacaac
cacatcggcatctccttcatcccccgggaggtgggtgaacacctggtcagcatcaagaag
aacggcagccacgttgccaacagccccgtgtccatcatggtggtccagtctgagatcggt
gatgcacgcagagccaaagtctatggccgtggcctgtcagagggccggactttcgaaatg
tctgaattcatcgtggacacaagggatgcgggttatggtggcatatccttggctgtggaa
ggccccagcaaagtggacatccagacagaggacctggaagatggcacctgcaaggtctcc
tacttccccactgtgcctggggtttacatcgtctccaccaagtttgctgatgagcacgtg
cctgggagcccgtttaccgtgaagatcagcggagagggaagagtcaaggagagcatcacc
cgtaccagtcgggccccgtctgtcgccactgtcggaagcatctgtgacctgaacctgaaa
atcccagaaattgacagcagtgacatgtcggcccatgtcaccagcccctctggccgcgtg
accgaggcagagattgtgtccatggggaagaactcgcactgcgtccggtttgtgccccag
gagatgggtgttcacacagtcagcgtcaagtaccgcggccagcatgtgaccggcagccct
ttccagttcacggtggggccactcggcgaggggggcgcccacaaggtccgtgcgggaggc
cccggcctggagagaggagaagcaggtgtcccagctgagttcagcatctggacccgggaa
gcaggcgctgggggcttgtccattgctgttgagggccccagtaaggccgagattacgttc
gatgaccataaaaatggatcgtgcggtgtgtcttacattgcccaggagcctggtaactac
gaggtatccatcaagttcaacgatgagcacatccctgaaagtccctacctggtgccagtc
atcgcgccgtccgacgacgcccgccgcctcactgttctgagccttcaggaatcgggatta
aaagttaaccagccagcctcctttgctataaggttgaatggggcaaaaggcaagattgat
gcaaaggtgcacagcccgtcaggagccgtggaggagtgtcatgtgtctgagctcgagcca
gataagtatgccgttcgcttcatcccccacgagaatggcatccacacgatcgatgtcaag
ttcaacgggagccacgtggttggaagccccttcaaagtgcgcgtcggggatcctggacag
gcggggaaccctgccctggtgtccgcctatggcgcggggctcgaggggggcaccacaggt
atccagtctgaatttttcatcaacaccacccgagcagggccagggacattatctgtcacc
attgaaggaccctccaaggttaaaatggattgccaggaaaccccagaagggtacaaagtc
atgtacacccccatggctcctggaaactacctgattggtgtcaaatatggcgggcccaac
cacattgtgggcagtcctttcaaggccaaggtgacaggccagcgtctggtcagccctggc
tcagccaacgagacctcatctattctggtggagtcggtgaccaggtcatccacagagacc
tgctatagcgccatccccaaggcctcctcggacgccagcaaggtgacctccaagggggca
gggctctcgaaggcctttgtgggccagaagagctccttcttggtggactgcagcaaagcc
ggttccaacatgctgctgattggtgtccatggaccaaccaccccctgcgaagaggtctcc
atgaagcatgtgggcaaccaacaatacaatgtcacatacgttgtcaaggagaagggggat
tatgttctggccgtgaagtggggagaggaacacatccccggcagccccttccacgtcaca
gtgccttaa

DBGET integrated database retrieval system