KEGG   Felis catus (domestic cat): 101098924Help
Entry
101098924         CDS       T02385                                 

Gene name
PFN3
Definition
profilin 3
Orthology
K05759  
profilin
Organism
fca  Felis catus (domestic cat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101098924 (PFN3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101098924 (PFN3)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101098924 (PFN3)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101098924 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 137 aa AA seqDB search
MGDWKGYISAVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI
LNKTVHELINGLRKQGT
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggactggaaaggctatatcagtgcagtgctgcgggaccagcgtattgatgacgtg
gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctggaggccttcta
gctgccatatcaccgcaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg
caggccggcctgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct
gagggagatggtgttctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg
ggccacaccccgcgcgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc
ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system