KEGG   Felis catus (domestic cat): 101099061Help
Entry
101099061         CDS       T02385                                 

Gene name
LYPLA2
Definition
lysophospholipase II
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101099061 (LYPLA2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101099061 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C1
AA seq 281 aa AA seqDB search
MAGFPGLERKFRRGRPRGKRVCLCRRKRRIAREVSKPPGSGGPSRGALQCMCGNTMSVPL
LTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKM
VMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLY
TALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEK
LRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctgggttcccgggactcgaacggaagttccggcgggggcggccgagggggaagaga
gtgtgtctgtgcaggagaaagaggagaatcgcccgagaggtctcgaaacccccagggagt
ggaggccccagccgtggagccctgcagtgtatgtgtggtaacaccatgtctgtgcccctg
ctcaccgatgctgccactgtgtctggagctgagcgggaaacggctgcggttattttttta
cacggacttggagacacagggcacagctgggctgacgccctctccaccatccggctccct
cacgtcaagtacatctgtccccatgcaccccggatccctgtgacgctcaacatgaagatg
gtgatgccctcctggtttgacctaatggggctgagtcctgatgccccagaggacgaggcc
ggcatcaagaaggcagcagagaacatcaaggccttgattgagcacgagatgaagaatggg
atccctgccaatcgaatcgtcctgggaggcttttcacagggcggggccctgtccctctac
acggcccttacctgtccccaccccctggctggcatagtggcattgagctgctggctgcct
ctgcatcgggccttcccccaggcagccaatggcagcgccaaggacctggccatcttgcag
tgccacggggagctggaccccatggttccagtacggtttggggccctgacggccgagaag
cttcggtccgtcgtcacacccgccagggtccagttcaagacgtacccaggtgtcatgcac
agctcctgccctcaggagatggcagccgtgaaggagtttcttgagaagctgctgcctcct
gtctaa

DBGET integrated database retrieval system