KEGG   Felis catus (domestic cat): 101099142Help
Entry
101099142         CDS       T02385                                 

Gene name
EIF4E2
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101099142 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101099142 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    101099142 (EIF4E2)
   04150 mTOR signaling pathway
    101099142 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101099142 (EIF4E2)
Translation factors [BR:fca03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    101099142 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 245 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQGSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagacgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacagaacgagacaagagtcagggc
agcagtaagaggaaggctgttgtccctggaccagcagagcatcccctgcagtacaactat
actttctggtactccagaagaacccccggccgtcccactagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtccgtcccggggacctgacaggccacagtgacttccatctcttcaaagaaggaatt
aaacctatgtgggaggatgatgcaaataaaaatggtggcaagtggattattcggctgcgg
aagggcttggcatcccgttgctgggagaatctcatcctggccatgttgggggaacagttc
atggttggggaggagatctgtggggctgtggtctctgtccggtttcaggaggacattatt
tcaatatggaataagactgccagtgaccaagcaaccacagcccgaatccgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggagtacaaaacccacaccgacagc
atcaaaatgccaggcaggctgggcccccaaaggctcctttttcaaaacctctggaagccg
cggttgaatgtgccatga

DBGET integrated database retrieval system