KEGG   Felis catus (domestic cat): 101099228Help
Entry
101099228         CDS       T02385                                 

Gene name
HDAC1
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101099228 (HDAC1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101099228 (HDAC1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101099228 (HDAC1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101099228 (HDAC1)
   05202 Transcriptional misregulation in cancers
    101099228 (HDAC1)
   05203 Viral carcinogenesis
    101099228 (HDAC1)
   05220 Chronic myeloid leukemia
    101099228 (HDAC1)
  Neurodegenerative diseases
   05016 Huntington's disease
    101099228 (HDAC1)
  Substance dependence
   05034 Alcoholism
    101099228 (HDAC1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    101099228 (HDAC1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101099228 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctatcgaaaaatggaaatatatcgccctcacaaggccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaaacagatgcagagattcaacgttggtgaggactgt
ccggtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcat
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccgggaactggggacctacgggatattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacccagtgcagttgtcttacag
tgtggctctgactccctatctggggatcggttaggttgcttcaacctgaccatcaaaggg
cacgccaagtgtgtagagtttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggcggttataccatccgtaacgtggcccgctgctggacgtatgaaacagccgtggctctg
gacacggagatcccaaatgagcttccatacaacgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacaccaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgcgaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgttcctctgacaaacgaatcgcctgtgaggaagagttc
tcggactctgatgaagagggagaaggcggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system