KEGG   Felis catus (domestic cat): 101099228Help
Entry
101099228         CDS       T02385                                 

Gene name
HDAC1
Definition
histone deacetylase 1
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:fca04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:fca04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:fca04919]
Human Diseases; Cancers; Pathways in cancer [PATH:fca05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:fca05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:fca05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:fca05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:fca05016]
Human Diseases; Substance dependence; Alcoholism [PATH:fca05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:fca05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
C1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctatcgaaaaatggaaatatatcgccctcacaaggccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcttgcgctccatccgc
ccagataacatgtctgagtacagcaaacagatgcagagattcaacgttggtgaggactgt
ccggtatttgatggcctgtttgagttctgtcagttatctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcat
catgcaaagaagtctgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccgggaactggggacctacgggatattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccaacccagtgcagttgtcttacag
tgtggctctgactccctatctggggatcggttaggttgcttcaacctgaccatcaaaggg
cacgccaagtgtgtagagtttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggcggttataccatccgtaacgtggcccgctgctggacgtatgaaacagccgtggctctg
gacacggagatcccaaatgagcttccatacaacgactactttgaatactttggaccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaacaccaatgagtacctggag
aagatcaaacagcgactgtttgagaacctgcgaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgttcctctgacaaacgaatcgcctgtgaggaagagttc
tcggactctgatgaagagggagaaggcggtcgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaactgaggatgaaaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

DBGET integrated database retrieval system