KEGG   Felis catus (domestic cat): 101099565Help
Entry
101099565         CDS       T02385                                 

Gene name
MGST1
Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101099565 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101099565 (MGST1)
   00982 Drug metabolism - cytochrome P450
    101099565 (MGST1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101099565 (MGST1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101099565 (MGST1)
  Drug resistance
   01524 Platinum drug resistance
    101099565 (MGST1)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101099565 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 155 aa AA seqDB search
MVDLTELMENEVFMAFASYTTIILSKMMFMSTATAFFRLTRKVFANPEDCAGFGKGENAK
KYLRTDDKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTVA
YLTPLPQPNRALAFFLGYGVTFSMAYRLLKSRLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgatctcactgagctaatggaaaatgaagtattcatggcctttgcttcctataca
acgattattctttcaaaaatgatgtttatgagtactgcaactgcattctttagattgaca
agaaaggtttttgccaacccagaagactgtgcagggtttggcaaaggagaaaatgccaag
aaatatcttcggacagatgacaaagtggaacgtgtgcgaagagctcacctgaatgacctt
gaaaacattgtgccatttcttggtattggccttctgtattccttgagtggtccagatctc
tctacagccatcctgcacttcagactctttgttggagcacggatctaccacacagtcgcg
tatttgacaccccttccccagccaaatcgtgctttggctttctttcttggctatggagtt
actttttcaatggcttacaggttgctaaagagtagattgtacctgtaa

DBGET integrated database retrieval system