KEGG   Felis catus (domestic cat): 101099565Help
Entry
101099565         CDS       T02385                                 

Gene name
MGST1
Definition
microsomal glutathione S-transferase 1
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101099565 (MGST1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101099565 (MGST1)
   00982 Drug metabolism - cytochrome P450
    101099565 (MGST1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101099565 (MGST1)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101099565 (MGST1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 155 aa AA seqDB search
MVDLTELMENEVFMAFASYTTIILSKMMFMSTATAFFRLTRKVFANPEDCAGFGKGENAK
KYLRTDDKVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVGARIYHTVA
YLTPLPQPNRALAFFLGYGVTFSMAYRLLKSRLYL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggttgatctcactgagctaatggaaaatgaagtattcatggcctttgcttcctataca
acgattattctttcaaaaatgatgtttatgagtactgcaactgcattctttagattgaca
agaaaggtttttgccaacccagaagactgtgcagggtttggcaaaggagaaaatgccaag
aaatatcttcggacagatgacaaagtggaacgtgtgcgaagagctcacctgaatgacctt
gaaaacattgtgccatttcttggtattggccttctgtattccttgagtggtccagatctc
tctacagccatcctgcacttcagactctttgttggagcacggatctaccacacagtcgcg
tatttgacaccccttccccagccaaatcgtgctttggctttctttcttggctatggagtt
actttttcaatggcttacaggttgctaaagagtagattgtacctgtaa

DBGET integrated database retrieval system