KEGG   Felis catus (domestic cat): 101099773Help
Entry
101099773         CDS       T02385                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101099773
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     101099773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 101099773
NCBI-ProteinID: XP_003999428
Ensembl: ENSFCAG00000013104
UniProt: M3WI84
Position
F1
AA seq 305 aa AA seqDB search
MGFQPSPVLLASLGVGLLTVLGLALGSYLVRKSRRPKVTLLDPNEKYLLRLLDKTTVSHN
TKRFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLNSLKIGDVVEFRGPSGLLTYTGKGNFSIQPNKKSPPEPQVAKKLG
MIAGGTGITPMLQLIRAILKDFEDPTQCSLLFANQTEKDIILREELEELQARYPSRFKLW
FTLDHPPEDWAYSKGFVTADMIREHLPAPGDGVLLLLCGPPPMVQLACHPNLDKLGYSQK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgggcttccaaccgagcccagtcctgctggcctccctgggggtggggctgctgactgtg
cttggcctggctttgggctcgtacttggttcgaaagtcccgccggccaaaggtcactctc
ctggaccccaatgagaagtacctgctgcgactgctagacaagacgactgtgagccacaac
accaagaggttccgctttgccctgcccaccgcccaccacgttctggggctgcctgtgggc
aaacatgtctacctctctgcccggatcgatggcagcctggtcatcaggccatatactcct
gtcaccagtgacgaggaccaaggctacgtggatcttgtcatcaaggtgtacctgaagggt
gtgcaccccaaatttcctgagggagggaagatgtctcagtacctaaacagcctgaagatt
ggggatgtggtggaatttcgagggccaagtggtttgctcacttacactgggaaagggaat
tttagcattcagcccaacaaaaaatctccgccagaaccccaagtggcgaagaaactggga
atgattgccggcggaacaggaatcaccccaatgctgcagctgattcgggccatcctgaag
gactttgaagatccgacccagtgctctctgctttttgccaaccagactgaaaaggacata
atcttgcgggaggagctggaggaactgcaggcccgatatcccagtcgctttaagctctgg
ttcactctggatcaccccccagaagattgggcctacagcaaggggtttgtgactgctgac
atgatccgggaacacctgcccgccccaggggatggcgtgctgctgctgctctgcgggcca
ccccccatggtgcagctggcctgccatcccaacttggacaaactgggctactcacaaaag
atgcgattcacctactga

DBGET integrated database retrieval system