KEGG   Felis catus (domestic cat): 101099917Help
Entry
101099917         CDS       T02385                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101099917 (P4HB)
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101099917 (P4HB)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101099917 (P4HB)
  Exosomal proteins of colorectal cancer cells
   101099917 (P4HB)
  Exosomal proteins of bladder cancer cells
   101099917 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 515 aa AA seqDB search
MLRRVLLCLALAVLTRAGAAAPEEEDHVLVLKCQEKVGEAGALGRRCFPASVSSPDAPWC
GHCKALAPEYAKAAGRLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTAAP
REYTAGREAEDIVNWLKKRTGPAASTLPDRAAAEALLESSEVTVIGFFKDVESDFAKQFL
LAAEAIDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGDITKDKLLDFIKHNQ
LPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYESKLSNFKKAAERFKGKILFIFIDS
DHTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAAKIEEFCHRFLEGKIKP
HLMSQELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGET
YKDHENVVIAKMDSTANEVEAVKVHSFPTLKFFPAGADRAVIDYNGERTLDGFKKFLESG
GQDGAGDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgttctgctctgcctggccctggccgtgctgacgcgcgcgggcgccgcc
gctccggaggaggaggaccacgtcctggtgctgaagtgccaggagaaggtgggggaagcg
ggggcacttggtcgacgctgctttccagcatccgtttcttctccagatgcgccatggtgt
ggccactgcaaggctctggcccccgagtatgccaaagcagctggcaggctgaaggcggaa
ggctcggagatcagactggcaaaggtagatgccaccgaggagtccgatctggctcagcag
tatggtgtgcgtggctaccctacaatcaagttcttcaagaacggagacaccgctgccccc
agagagtacacagctggcagagaagccgaggacatcgtgaactggctgaagaaacgcacc
ggccccgccgccagcacgctgcccgacagggccgccgcggaggccttgctggagtccagc
gaagtgaccgtcatcggcttcttcaaggatgtggagtcggactttgccaagcagttcctg
ctggcagcggaggccatcgatgacataccttttgggatcacgtccaacagcgacgtgttc
tccaaataccagctggacaaggatggggttgtgctcttcaagaagtttgatgaaggccgg
aacaacttcgagggggacatcaccaaagacaagctgttggacttcatcaagcacaaccag
ctgccgctggtcatcgagttcactgagcagacagccccgaagattttcggaggtgaaatc
aagactcacatcctgctattcctgcccaagagcgtgtctgactatgagagcaaactgagc
aacttcaagaaggccgccgagcgcttcaaggggaagattctgttcatcttcatcgacagc
gaccacacggacaaccagcggatcctggagttcttcggcctcaagaaggaggagtgcccc
gccgtgcgcctcatcaccctggaggaggagatgaccaagtacaagccggagtcggacgag
ctgacggcggcgaagattgaagagttctgccaccgcttcctggagggcaagatcaagccc
cacctgatgagccaggagctgcccgaagactgggacaagcagcccgtcaaagtgctggtc
gggaaaaacttcgaagaagttgcttttgacgagaaaaagaacgtcttcgtggaattctat
gccccgtggtgtgggcactgcaaacagttggcccccatctgggacaagctgggagagacg
tacaaggaccatgaaaacgtcgtcatcgccaagatggattcgacggctaacgaggtggag
gccgtgaaagtgcacagcttccccacactgaagttcttcccagccggcgccgacagagcg
gtcattgattacaacggggagcggacactagacggttttaagaagttcttggagagcggt
gggcaggacggggccggagacgacgatgacctagaagatctggaagaggcggaagagcct
gacctggaggaagatgacgatcagaaagctgtgaaggatgaactgtga

DBGET integrated database retrieval system