KEGG   Felis catus (domestic cat): 101099917Help
Entry
101099917         CDS       T02385                                 

Gene name
P4HB
Definition
(RefSeq) protein disulfide-isomerase isoform X1
  KO
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101099917 (P4HB)
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101099917 (P4HB)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101099917 (P4HB)
Membrane trafficking [BR:fca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101099917 (P4HB)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101099917 (P4HB)
  Exosomal proteins of colorectal cancer cells
   101099917 (P4HB)
  Exosomal proteins of bladder cancer cells
   101099917 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
E1
AA seq 510 aa AA seqDB search
MLRRVLLCLALAVLTRAGAAAPEEEDHVLVLHKGNFEEALAAHKYLLVEFYAPWCGHCKA
LAPEYAKAAGRLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTAAPREYTA
GREAEDIVNWLKKRTGPAASTLPDRAAAEALLESSEVTVIGFFKDVESDFAKQFLLAAEA
IDDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGDITKDKLLDFIKHNQLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYESKLSNFKKAAEHFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAAKIEEFCHRFLEGKIKPHLMSQ
ELPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
NVVIAKMDSTANEVEAVKVHSFPTLKFFPAGADRAVIDYNGERTLDGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDLEEDDDQKAVKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgttctgctctgcctggccctggccgtgctgacgcgcgcgggcgccgcc
gctccggaggaggaggaccacgtcctggtgctgcacaagggcaacttcgaggaggcgctg
gcggcccacaagtacctgctggtggagttctatgcgccatggtgtggccactgcaaggct
ctggcccccgagtatgccaaagcagctggcaggctgaaggcggaaggctcggagatcaga
ctggcaaaggtagatgccaccgaggagtccgatctggctcagcagtatggtgtgcgtggc
taccctacaatcaagttcttcaagaacggagacaccgctgcccccagagagtacacagct
ggcagagaagccgaggacatcgtgaactggctgaagaaacgcaccggccccgccgccagc
acgctgcccgacagggccgccgcggaggccttgctggagtccagcgaagtgaccgtcatc
ggcttcttcaaggatgtggagtcggactttgccaagcagttcctgctggcagcggaggcc
atcgatgacataccttttgggatcacgtccaacagcgacgtgttctccaaataccagctg
gacaaggatggggttgtgctcttcaagaagtttgatgaaggccggaacaacttcgagggg
gacatcaccaaagacaagctgttggacttcatcaagcacaaccagctgccgctggtcatc
gagttcactgagcagacagccccgaagattttcggaggtgaaatcaagactcacatcctg
ctattcctgcccaagagcgtgtctgactatgagagcaaactgagcaacttcaagaaggcc
gccgagcacttcaaggggaagattctgttcatcttcatcgacagcgaccacacggacaac
cagcggatcctggagttcttcggcctcaagaaggaggagtgccccgccgtgcgcctcatc
accctggaggaggagatgaccaagtacaagccggagtcggacgagctgacggcggcgaag
attgaagagttctgccaccgcttcctggagggcaagatcaagccccacctgatgagccag
gagctgcccgaagactgggacaagcagcccgtcaaagtgctggtcgggaaaaacttcgaa
gaagttgcttttgacgagaaaaagaacgtcttcgtggaattctatgccccgtggtgtggg
cactgcaaacagttggcccccatctgggacaagctgggagagacgtacaaggaccatgaa
aacgtcgtcatcgccaagatggattcgacggctaacgaggtggaggccgtgaaagtgcac
agcttccccacactgaagttcttcccagccggcgccgacagagcggtcattgattacaac
ggggagcggacactagacggttttaagaagttcttggagagcggtgggcaggacggggcc
ggagacgacgatgacctagaagatctggaagaggcggaagagcctgacctggaggaagat
gacgatcagaaagctgtgaaggatgaactgtga

DBGET integrated database retrieval system