KEGG   Felis catus (domestic cat): 101099994Help
Entry
101099994         CDS       T02385                                 

Gene name
PFN2
Definition
(RefSeq) profilin 2
  KO
K05759  
profilin
Organism
fca  Felis catus (domestic cat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101099994 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101099994 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101099994 (PFN2)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101099994 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C2
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAYELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc
cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac
gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac
ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg
taa

DBGET integrated database retrieval system