KEGG   Felis catus (domestic cat): 101100013Help
Entry
101100013         CDS       T02385                                 

Gene name
PDK2
Definition
pyruvate dehydrogenase kinase, isozyme 2
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     101100013 (PDK2)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   101100013 (PDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 375 aa AA seqDB search
MKQFLDFGSSNACEKTSFTFLRQELPVRLANIMKEINLLPDRVLSTPSVQLVQSWYVQSL
LDIMEFLDKDPEDHRTLSQFTDALITIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQ
YFLDRFYLSRISIRMLINQHTLIFDGSTNPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLC
DKYYMASPDLEIQEINTSNSKQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLVLPP
IKVMVALGEEDLSIKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPI
SRLYAKYFQGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWC
VPSTEPKNTSTYRVS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagtttctggacttcgggtccagcaatgcctgtgagaaaacgtcattcaccttc
ctgaggcaggagctgcccgtgcgcctggccaacatcatgaaagagattaacctgcttccc
gaccgggtgctgagcacgccctcggtacagctggtccagagctggtatgtccaaagtctc
ctggacatcatggagttcctggacaaagaccccgaggaccatcgtaccctgagccagttc
accgatgccctgatcaccatccggaaccgccacaacgacgtggtgcccaccatggcgcag
ggcgtgctggagtacaaggacacctacggcgacgacccggtctccaaccagaacatccag
tactttctggaccgcttctacctcagccgcatctccatccgcatgctcatcaaccagcac
accctgatttttgacggcagcaccaacccggcccaccccaaacacattggcagcatcgac
cccaactgcaacgtctccgaggtggtgaaggatgcctatgatatggccaagctcctgtgt
gacaagtactacatggcctcccctgacttggagatccaagagatcaatacctccaactcc
aaacagccaattcacatggtctatgtcccttcccacctctaccacatgctttttgaactc
ttcaagaatgccatgcgcgcaactgtggaaagccacgagtccagccttgtcctcccacct
atcaaggtcatggtggccttgggtgaggaagatctgtccatcaaaatgagtgaccggggt
gggggagtccccctgaggaagatcgagcgactcttcagctacatgtactccacagccccc
accccccagccaggcactggagggaccccgctggctggcttcgggtacgggctccccatt
tcccgcctctacgccaagtacttccagggagacctgcagctcttctccatggagggcttt
gggaccgatgctgtcatctacctcaaggccctgtccacggactccgtggaacgcctgccc
gtctacaacaagtcagcctggcgtcactaccagaccatccaggaggcgggcgactggtgt
gtgcccagcacggagcccaagaacacgtccacctaccgtgtcagctag

DBGET integrated database retrieval system