KEGG   Felis catus (domestic cat): 101100013Help
Entry
101100013         CDS       T02385                                 

Gene name
PDK2
Definition
(RefSeq) pyruvate dehydrogenase kinase, isozyme 2
  KO
K00898  pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     101100013 (PDK2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   101100013 (PDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 101100013
NCBI-ProteinID: XP_003996783
Ensembl: ENSFCAG00000009633
UniProt: M3WBT2
Position
E1
AA seq 407 aa AA seqDB search
MRWVRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALITIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINTSNSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLVLPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggtccgcgcgctgctgaaaaatgcgtccctggcaggggcgcccaagtacatc
gaacacttcagcaagttctccccgtccccgctgtccatgaagcagtttctggacttcggg
tccagcaatgcctgtgagaaaacgtcattcaccttcctgaggcaggagctgcccgtgcgc
ctggccaacatcatgaaagagattaacctgcttcccgaccgggtgctgagcacgccctcg
gtacagctggtccagagctggtatgtccaaagtctcctggacatcatggagttcctggac
aaagaccccgaggaccatcgtaccctgagccagttcaccgatgccctgatcaccatccgg
aaccgccacaacgacgtggtgcccaccatggcgcagggcgtgctggagtacaaggacacc
tacggcgacgacccggtctccaaccagaacatccagtactttctggaccgcttctacctc
agccgcatctccatccgcatgctcatcaaccagcacaccctgatttttgacggcagcacc
aacccggcccaccccaaacacattggcagcatcgaccccaactgcaacgtctccgaggtg
gtgaaggatgcctatgatatggccaagctcctgtgtgacaagtactacatggcctcccct
gacttggagatccaagagatcaatacctccaactccaaacagccaattcacatggtctat
gtcccttcccacctctaccacatgctttttgaactcttcaagaatgccatgcgcgcaact
gtggaaagccacgagtccagccttgtcctcccacctatcaaggtcatggtggccttgggt
gaggaagatctgtccatcaaaatgagtgaccggggtgggggagtccccctgaggaagatc
gagcgactcttcagctacatgtactccacagcccccaccccccagccaggcactggaggg
accccgctggctggcttcgggtacgggctccccatttcccgcctctatgccaagtacttc
cagggagacctgcagctcttctccatggagggctttgggaccgatgctgtcatctacctc
aaggccctgtccacggactccgtggaacgcctgcccgtctacaacaagtcagcctggcgt
cactaccagaccatccaggaggcgggcgactggtgtgtgcccagcacggagcccaagaac
acgtccacctaccgtgtcagctag

DBGET integrated database retrieval system