KEGG   Felis catus (domestic cat): 101100228Help
Entry
101100228         CDS       T02385                                 

Gene name
GLS2
Definition
glutaminase 2 (liver, mitochondrial)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101100228 (GLS2)
   00330 Arginine and proline metabolism
    101100228 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101100228 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101100228 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    101100228 (GLS2)
   04727 GABAergic synapse
    101100228 (GLS2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101100228 (GLS2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101100228 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 602 aa AA seqDB search
MRSMRALQNALSGAGSHCWLGGWGHLSRSPLLGGGVRHHLSEAAALGRETPHSHQPQHRD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRRMVR
ESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTSHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTDYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctctatgagggctctgcagaatgcgctgagcggggccggcagtcactgctggctg
ggaggctggggtcacctgagccggagccctcttcttggcgggggcgtccggcaccacctc
agtgaggccgcggcgctgggcagagagacgccgcacagccaccagccgcagcaccgggat
catgattcatcagagagtggcatgctgtcgcgcctgggtgatctgctcttctacactatt
gctgagggacaggaacgaatccctatccacaagttcactactgcactgaaggccactgga
ctgcagacatcagatccccggcttcgggactgcatgagccagatgcgccgcatggttcga
gagtccagcagtggtggcctcttggaccgagatctcttccaaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgagccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtggcg
gcctacatccctcagctggccaaatccaatccagacctgtggggtgtctccctgtgcact
gtggatggtcagcggcactccgtgggccacacaaagatccccttctgcctgcagtcttgt
gtgaagcccctcacctatgccatctccataagcaccctaggcactgactacgtgcacaag
tttgtgggcaaggagcccagtggcctacgttacaacaagctctctctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgttgtgagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtattacagtatctgaacaaaatggctggg
aacgaatacatgggtttcagcaatgctacattccagtcagagaaggaaacaggggatcgg
aattatgccattggctactatctaaaggaaaagaagtgctttcctaagggggtggacatg
atggctgcccttgatctctatttccagctgtgctccgtggaggtgacctgtgagtcaggc
agtgtcatggcagccaccctggccaatggcgggatctgccccatcacaggagagagcgtg
ctgagcgctgaagcagtgcgcaacaccctcagcctcatgcattcctgcggcatgtacgac
ttctcaggccagtttgccttccatgtgggcctgccagccaagtcagctgtgtcaggagcc
atcctcctagtagtacctaatgtcatgggaatgatgtgtctgtcacctccactggacaag
ctagggaacagccacaggggcatcagcttctgccagaagttggtgtctctcttcaatttc
cacaactatgacaacctgaggcattgtgctcggaagttagacccacggcgtgaaggggga
gaagttcggaacaagactgtggtgaacctattatttgctgcctatagtggagatgtctca
gctcttcgaaggtttgccttgtcagccatggacatggaacagaaagattatgactcccgc
acagccttgcatgttgctgcagctgaaggacacatcgaagttgttaaattcctgattgag
gcttgcaaagtgaatccttttgttaaggacaggtggggcaacattcccctggatgatgct
gtgcagttcaaccacctggaggtggtgaaactgcttcaggattaccaggactcctataca
ccatctgagactcaggccgaagcagcggccgaggccctgtccaaggagaacttagagagc
atggtgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system