KEGG   Felis catus (domestic cat): 101100313Help
Entry
101100313         CDS       T02385                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B4
AA seq 623 aa AA seqDB search
MENVALWLGLELGSSRTMTKFSDKDLERRKVECKPLVQVQKPPPKIKNLRMTRLLPKNTN
TSITSLPFVDTKGKKNMVNLPHISNKILLKPPLLYQENQTHNQMSASELKTSEMPFHSSI
KTQDPKPEEKPPRKHKVPLTAAEALKFFKNQLSSYEQSEILGYTELWFLGLEAKKLHVTP
EFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNELVALKIIRNK
KRFHHQALVELKILEALRRKDKDNTYNVVHMKDFFYFRNHLCITFELLGINLYELMKNNS
FQGFSLSIVRRFTLSVLKCLQMLYVEKIIHCDLKPENIVLYQKGQVSVKVIDFGSSCYEH
QKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGENEVEQLACIME
VLGLPPTHFIQTASRRQTFFDSKGFPKNMTNNRGRKRYPDSKDLTMVLKTYDASFLDFLR
RCLVWEPSLRMTPDQALKHAWIHEPRNFKPRSRPQTLRKPSLCFPSEARKEKVQGHHPLG
KKEVTIKEETIDKIKGGTTKQVQNSGDQQGILQHTSEVVQLPQLTEASRKPEAVAGPEES
KTSPGHRSKNSSSKNMNILPPIV
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtggcactttggctgggacttgaacttggaagttcaaggacaatgacaaag
ttcagtgacaaggacttggaacggaggaaggttgagtgtaagcctttggttcaagtccag
aagccacctcccaagatcaagaacctcagaatgactcgactcttgcctaagaatacaaac
accagcattacttcactcccttttgtggataccaaggggaagaagaacatggttaacctc
ccacacatcagcaacaaaatcttactaaagccacccttgctgtatcaggagaatcagact
cacaatcagatgtcagcttctgagctcaagacttcagaaatgcctttccattcaagcatt
aaaacccaagatcccaagccagaggagaaaccaccaagaaagcacaaggtgcctctgaca
gcagcagaggccctaaagttttttaagaaccagctgtcttcttatgaacaaagtgagatc
ctgggctacacggagctgtggttcctggggctggaagcaaagaagctccacgtgactcct
gagttcagcaaaacgagttttgatgatgaacatggctcctatatgaaggtcctgcatgac
cacattgcctaccgctatgaggttttggagatgatcgggaaagggtcctttggacaggtg
gccaagtgcttggatcacaaaaataatgagttggtggccttgaaaatcatcaggaacaag
aagagatttcaccaccaggcactggtggagctgaagatcctggaggctctcagaaggaag
gacaaagacaacacctacaatgtggtgcacatgaaagactttttctattttcgcaatcat
ctctgcatcacctttgaactcttgggaatcaacttgtatgagctgatgaagaataatagc
tttcaaggcttcagtctgtcaatagttcggcgcttcaccctctctgttttgaagtgtttg
caaatgctttatgtagagaaaatcattcactgtgatctcaagcctgagaatatagtgtta
taccaaaagggccaagtctctgttaaggtcattgactttggatcaagttgttatgaacac
cagaaagtatatacctatatccaaagccggttctacagatccccagaagtgattctaggc
catccctacaacatggccattgatatgtggagcctgggctgcatcatggctgagttgtac
acgggctaccctctgtttcctggggagaatgaagtagagcagctagcctgcatcatggag
gtgctgggcctgccgccaacccacttcattcagacagcctccaggagacagacatttttt
gattccaaaggttttcctaaaaatatgaccaacaacagggggagaaaaagatacccagat
tccaaggatctcacgatggtgctgaaaacctacgatgccagcttcctggactttctcaga
agatgtttggtatgggaaccttctcttcgcatgacccctgaccaggccctcaagcatgct
tggattcatgagccacggaatttcaaaccacggtccaggccccagaccctgaggaaaccc
agtctctgtttcccctctgaggctcggaaggaaaaggttcaagggcatcatcccttgggc
aaaaaagaggtgaccatcaaagaagagaccatagacaaaataaaaggtggcaccactaag
caggttcagaattcaggtgaccagcagggcattctccagcacacatctgaagttgtccag
ttgcctcagctaacagaagcttccagaaagccagaggcagttgctggaccagaggagtcc
aaaacctccccagggcatcgaagtaaaaactcctcatccaaaaacatgaatattttacca
cctattgtatga

DBGET integrated database retrieval system