KEGG   Felis catus (domestic cat): 101100313Help
Entry
101100313         CDS       T02385                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101100313 (DYRK4)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   101100313 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B4
AA seq 573 aa AA seqDB search
MTRLLPKNTNTSITSLPFVDTKGKKNMVNLPHISNKILLKPPLLYQENQTHNQMSASELK
TSEMPFHSSIKTQDPKPEEKPPRKHKVPLTAAEALKFFKNQLSSYEQSEILGYTELWFLG
LEAKKLHVTPEFSKTSFDDEHGSYMKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKNNE
LVALKIIRNKKRFHHQALVELKILEALRRKDKDNTYNVVHMKDFFYFRNHLCITFELLGI
NLYELMKNNSFQGFSLSIVRRFTLSVLKCLQMLYVEKIIHCDLKPENIVLYQKGQVSVKV
IDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYNMAIDMWSLGCIMAELYTGYPLFPGEN
EVEQLACIMEVLGLPPTHFIQTASRRQTFFDSKGFPKNMTNNRGRKRYPDSKDLTMVLKT
YDASFLDFLRRCLVWEPSLRMTPDQALKHAWIHEPRNFKPRSRPQTLRKPSLCFPSEARK
EKVQGHHPLGKKEVTIKEETIDKIKGGTTKQVQNSGDQQGILQHTSEVVQLPQLTEASRK
PEAVAGPEESKTSPGHRSKNSSSKNMNILPPIV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgactcgactcttgcctaagaatacaaacaccagcattacttcactcccttttgtggat
accaaggggaagaagaacatggttaacctcccacacatcagcaacaaaatcttactaaag
ccacccttgctgtatcaggagaatcagactcacaatcagatgtcagcttctgagctcaag
acttcagaaatgcctttccattcaagcattaaaacccaagatcccaagccagaggagaaa
ccaccaagaaagcacaaggtgcctctgacagcagcagaggccctaaagttttttaagaac
cagctgtcttcttatgaacaaagtgagatcctgggctacacggagctgtggttcctgggg
ctggaagcaaagaagctccacgtgactcctgagttcagcaaaacgagttttgatgatgaa
catggctcctatatgaaggtcctgcatgaccacattgcctaccgctatgaggttttggag
atgatcgggaaagggtcctttggacaggtggccaagtgcttggatcacaaaaataatgag
ttggtggccttgaaaatcatcaggaacaagaagagatttcaccaccaggcactggtggag
ctgaagatcctggaggctctcagaaggaaggacaaagacaacacctacaatgtggtgcac
atgaaagactttttctattttcgcaatcatctctgcatcacctttgaactcttgggaatc
aacttgtatgagctgatgaagaataatagctttcaaggcttcagtctgtcaatagttcgg
cgcttcaccctctctgttttgaagtgtttgcaaatgctttatgtagagaaaatcattcac
tgtgatctcaagcctgagaatatagtgttataccaaaagggccaagtctctgttaaggtc
attgactttggatcaagttgttatgaacaccagaaagtatatacctatatccaaagccgg
ttctacagatccccagaagtgattctaggccatccctacaacatggccattgatatgtgg
agcctgggctgcatcatggctgagttgtacacgggctaccctctgtttcctggggagaat
gaagtagagcagctagcctgcatcatggaggtgctgggcctgccgccaacccacttcatt
cagacagcctccaggagacagacattttttgattccaaaggttttcctaaaaatatgacc
aacaacagggggagaaaaagatacccagattccaaggatctcacgatggtgctgaaaacc
tacgatgccagcttcctggactttctcagaagatgtttggtatgggaaccttctcttcgc
atgacccctgaccaggccctcaagcatgcttggattcatgagccacggaatttcaaacca
cggtccaggccccagaccctgaggaaacccagtctctgtttcccctctgaggctcggaag
gaaaaggttcaagggcatcatcccttgggcaaaaaagaggtgaccatcaaagaagagacc
atagacaaaataaaaggtggcaccactaagcaggttcagaattcaggtgaccagcagggc
attctccagcacacatctgaagttgtccagttgcctcagctaacagaagcttccagaaag
ccagaggcagttgctggaccagaggagtccaaaacctccccagggcatcgaagtaaaaac
tcctcatccaaaaacatgaatattttaccacctattgtatga

DBGET integrated database retrieval system