KEGG   Felis catus (domestic cat): 101100540Help
Entry
101100540         CDS       T02385                                 

Gene name
SIRT6
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-6
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
fca  Felis catus (domestic cat)
Pathway
Thermogenesis
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    101100540 (SIRT6)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101100540 (SIRT6)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101100540 (SIRT6)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     101100540 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
A2
AA seq 359 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVRELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTKTHMALVQLERVGLLCFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGSMGLKATGRLCTVAKARGLRACRGE
LKDTVLDWEDALPDRDLTLADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMEHLGLEIPTWDGPRVLERALPPLPRPPAPKLEPK
EEAPTQLNGPAPASPKPEPSTEPCTQHNGSGPTSPKREPLDSPAPHRPPKRVKAEAVPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcgggactgtcgccgtacgcggacaagggcaagtgtggcctc
cccgagatcttcgaccccccggaggagttggagcggaaggtgcgggagctggcgcagctg
gtctggcagtcctccaatgtggtgttccacacgggggccggcatcagcaccgcctcgggc
atccccgacttcaggggcccccacggcgtctggacgatggaggagcggggcctggccccc
aaattcgacaccaccttcgagagcgcgcggcccacgaagacccacatggcactggtgcag
ctggagcgcgtgggcctcctgtgcttcctggtcagccagaacgtggacgggctgcacgtg
cgctccggcttccccagggacaagctggcggagcttcacggaaacatgttcgtggaggaa
tgcgccaagtgtaagacgcagtatgtccgggacaccgtcgtgggcagtatgggcctcaag
gccacgggccggctctgcaccgtggccaaggccagggggctgcgtgcttgcaggggcgaa
ctgaaggacaccgtcctggactgggaagacgccctgcctgaccgggacctcaccctcgcc
gacgaggccagcaggaacgcagacctgtccatcactctgggcacctccctgcaaatccgg
cccagcgggaacctcccactcgccaccaagcgccgaggaggtcgactggtcattgtcaac
cttcagcccaccaagcacgaccgccatgcagacctgcgtatccatggctacgtggatgag
gtcatgaccaggctcatggagcacctgggcctggagatccccacctgggatggccctcga
gtgctggagagggcgctgccccccctgcctcgcccgcctgcccccaagctggagcccaag
gaggaggcccccacccagctcaatggcccagcacccgccagccccaagccggagccctcc
accgagccctgtacccagcacaacggctctgggcctaccagccccaagagggagccgctg
gacagtcctgcaccccacaggccccccaagagggtgaaggctgaagcggttcccagctga

DBGET integrated database retrieval system