KEGG   Felis catus (domestic cat): 101100540Help
Entry
101100540         CDS       T02385                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
fca  Felis catus (domestic cat)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101100540 (SIRT6)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101100540 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A2
AA seq 429 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVRELAQLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTKTHMALVQLERVGLLCFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGSMGLKATGRLCTVAKARGLRACRGE
LKDTVLDWEDALPDRDLTLADEASRSDPTETGFSKRTPLAHESQASEVTPASAALLLAGW
GGCSGGTGSWHRLWVPLRADKGVERAAQAGLGVFRSTRRLVEHWGLSQEGLAASLALWSR
TRPVFAPCSPPPRPPQDRHADLRIHGYVDEVMTRLMEHLGLEIPTWDGPRVLERALPPXP
RPPAPKLEPKEEAPTQLNGPAPASPKPEPSTEPCTQHNGSGPTSPKREPLDSPAPHRPPK
RVKAEAVPS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcgggactgtcgccgtacgcggacaagggcaagtgtggcctc
cccgagatcttcgaccccccggaggagttggagcggaaggtgcgggagctggcgcagctg
gtctggcagtcctccaatgtggtgttccacacgggggccggcatcagcaccgcctcgggc
atccccgacttcaggggcccccacggcgtctggacgatggaggagcggggcctggccccc
aaattcgacaccaccttcgagagcgcgcggcccacgaagacccacatggcactggtgcag
ctggagcgcgtgggcctcctgtgcttcctggtcagccagaacgtggacgggctgcacgtg
cgctccggcttccccagggacaagctggcggagcttcacggaaacatgttcgtggaggaa
tgcgccaagtgtaagacgcagtatgtccgggacaccgtcgtgggcagtatgggcctcaag
gccacgggccggctctgcaccgtggccaaggccagggggctgcgtgcttgcaggggcgaa
ctgaaggacaccgtcctggactgggaagacgccctgcctgaccgggacctcaccctcgcc
gacgaggccagcaggtctgaccccacggaaacaggcttcagcaagcggacgcctctggcc
cacgagtcccaagcatcggaggtcacgcccgcatcagcagccctgcttctggccgggtgg
ggaggctgctccggggggacgggaagctggcacaggttgtgggtgcccttgagagcagac
aagggtgtggagcgagctgcccaggctggtctgggcgtgttccggagcaccaggcggctg
gtggagcactggggcttgagccaggaggggctggcagcctctctcgccttgtggagcagg
acccggcctgtctttgcaccctgctccccccccccccgccccccacaggaccgccatgca
gacctgcgtatccatggctacgtggatgaggtcatgaccaggctcatggagcacctgggc
ctggagatccccacctgggatggccctcgagtgctggagagggcgctgccccccntgcct
cgcccgcctgcccccaagctggagcccaaggaggaggcccccacccagctcaatggccca
gcacccgccagccccaagccggagccctccaccgagccctgtacccagcacaacggctct
gggcctaccagccccaagagggagccgctggacagtcctgcaccccacaggccccccaag
agggtgaaggctgaagcggttcccagctga

DBGET integrated database retrieval system