KEGG   Felis catus (domestic cat): 101100567Help
Entry
101100567         CDS       T02385                                 

Gene name
THBS2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:fca04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:fca04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:fca04510]
Human Diseases; Infectious diseases; Malaria [PATH:fca05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B2
AA seq 1172 aa AA seqDB search
MLWDLVLLALWAASGARAGDQDEDTAFNLFSISNINRKTIGAKQFRGPDPNVPAYRFVRF
DYIPPVSADYLSKIAKIVRQKEGFFLTASLKQDPKSRGTLLALEGPGASQRQFEIVSNGP
ADTLDLTYWIDGAQHVISLEDVGLADSQWKNITVQVTGETYSLYVGCDLIDSFTLDEPFY
EQLRTEKSRMYVAKGSARDNHFRGLLQNIYLVFENSVEDVLSKKGCQQSQGAEANAISEN
TETLHLSPQVATEYAGPGAHRRPEVCERSCEELGTMITELSGLHVIVNQLHENLRKVSND
NQVLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPATC
ANPSFVEGECCPSCFHSLDGEEGWSPWAEWTQCSATCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLGKCDHRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKGCQGTPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVQER
QMCNKRSCPVDGCLSNPCFPGAECSSFPDGSWSCGACPVGFLGNGTHCEDLDECAVVTDV
CFAVGKAQRCVNTNPGFHCLPCPPRYKGTQPFGVGLEAARTEKQVCEPENPCKDKTHACH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCSTNATYHCIKDNC
PLLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDIDNDLVGDQCDNNDDIDDDGHQNNQDNCPYIPNANQADHDHDGQGDACDSDD
DNDGVPDDRDNCRLVSNPGQEDSDGDGRGDACKDDFDNDSIPDIDDVCPENSAISETDFR
NFQMVHLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEEQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTQGQVRTLWHDPKNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggatctggtcctgctcgccctctgggccgcgtccggcgcgcgagctggcgac
caggacgaggacaccgccttcaaccttttcagcatcagcaacataaaccggaagaccatt
ggggccaagcagttccgggggcctgaccccaacgtgccagcgtatcgttttgtccgcttt
gactacatcccacccgtgagcgcagattacctcagcaagattgccaagatcgtgaggcag
aaagagggcttctttctcacggccagcctgaagcaggaccccaagtcccggggcacgctc
ctggctctggagggccccggcgcctcccagaggcagttcgagatcgtgtccaacggcccg
gccgacacgctggacctcacctactggatagacggcgctcagcacgttatctccctggag
gacgtgggcctggctgactcccagtggaagaacatcaccgtgcaggtgacaggggagacc
tacagcttgtacgtgggctgcgacctgatcgacagtttcacgctggacgagcctttctac
gagcagctgcggacagaaaagagcaggatgtacgtggccaaaggctctgctcgagacaat
cacttccggggtttgctgcagaacatctacttagtgttcgaaaactcagtggaagatgtt
ctaagcaagaaaggttgtcagcaaagtcagggagccgaagccaacgccatcagcgagaac
acggagacactgcacctgagccctcaggtggccacggagtacgcgggcccaggcgcgcac
aggaggccggaggtgtgcgaacgctcctgcgaggagctgggcaccatgatcaccgagctg
tcggggctgcacgtcatcgtgaaccagcttcacgagaacctgcggaaagtgtccaatgac
aaccaggtcctctgggagctcatcggcggcccgcccaagaccaggaacatgtccgcctgc
tggcaggacggccgcttcttcgcggaaaatgaaacctgggtggtggacagctgcaccaaa
tgcacctgcaagaaatttaaaaccgtttgccaccaaatcacctgcccgccggcgacctgt
gccaacccgtccttcgtggagggagaatgctgtccttcctgcttccactcactggacggt
gaggagggctggtccccctgggcggagtggacccagtgctctgccacctgcgggtcgggc
acccagcagagagggcggtcgtgtgacgtcaccagcaacacctgcttggggccgtccatc
cagacgcgggcgtgcagcctgggcaagtgtgaccaccgaatccggcaggatgggggctgg
agccactggtcgccgtggtcttcctgctctgtgacctgcggcgtgggcaacatcacccgc
atccggctctgcaactcgcccgtcccccagatggggggcaagaattgcaaggggagtggc
cgggagaccaaaggctgccagggcaccccgtgtccaatcgacggccggtggagcccctgg
tccccatggtcagcctgcacggtcacctgtgccggagggatccgggagcggacgcgcgtc
tgtaacagccccgagccccagcacgggggcaaggactgcgtgggggacgtccaagagcgt
cagatgtgcaataaaaggagctgtcctgtagacggctgcttgtccaacccgtgcttcccc
ggtgccgagtgcagcagctttccagacggctcctggtcctgcggcgcctgccccgtgggc
ttcctgggcaacggcacacactgtgaggacctggacgagtgtgccgtggtcaccgacgtc
tgcttcgccgtgggcaaagcccagcgctgcgtcaacaccaaccccggcttccactgcctg
ccgtgcccccctcgctacaaagggacccagccctttggcgtcggcctggaggcggccagg
acggagaagcaggtgtgtgagcctgagaacccgtgcaaagacaagactcacgcctgccac
aagcacgcggagtgcatctacctgggacacttcagcgaccccatgtacaagtgtgagtgc
cagacgggctacgcgggagacgggctcatctgcggggaggactcggacctggacggctgg
cccaacaagaacctggtgtgctccaccaatgccacctaccactgcatcaaggacaactgc
cccctgctgccgaattccgggcaagaagactttgacaaggacggcaccggtgacgcctgt
gacgatgatgacgacaatgacggcgtggacgatgagaaggacaactgccagcttctcttc
aacccccgccagttcgactatgacaaagatgaagtcggggaccgctgtgacaactgcccg
tatgtgcacaacccggcgcagatcgacacggacaacaacggcgagggcgacgcgtgctcc
gtggacattgacggagacgacgtcttcaacgagcgggacaattgtccctacgtctataac
accgaccagagagacacagacggggatggcgtgggcgatcactgcgacaactgccccctg
gtgcacaaccctgatcagaccgacatagacaacgacctcgtgggagaccagtgtgacaac
aatgatgacatcgacgacgatggccaccagaacaaccaagacaactgcccctacatcccc
aacgccaaccaggccgaccacgaccacgacggccagggcgacgcctgtgactcagacgat
gacaacgacggggtcccagacgacagggacaactgccggcttgtctccaaccctggccag
gaggactccgatggggacgggcgtggggacgcttgcaaagacgactttgataacgacagc
atcccagacatcgatgacgtgtgtcctgagaacagcgccatcagcgagaccgacttcagg
aacttccagatggtccacctggacccgaagggcaccactcagatcgaccccaactgggtc
attcgccatcagggcaaggagctggtgcagacggccaactcggaccccggcatcgctgtc
ggttttgacgagttcgggtccgtggacttcagcggcacgttctacgtcaacaccgaccgg
gacgatgactacgccggctttgtcttcggctaccagtccagcagccgcttctacgtggtc
atgtggaagcaggtcacccagacctactgggaagagcagcccactcgggcttacggctac
tcgggcgtgtccctcaaggtggtgaactccaccacgggcaccggcgagcacctgaggaac
gcgctctggcataccgggaacacgcaaggccaggtgcgcacgttatggcacgaccccaaa
aacattggctggaaggactacactgcttacaggtggcatctgacccacagaccgaagacg
ggctacataagagtcttagtgcatgaaggaaaacaggtcatggcggactcgggacccatc
tatgaccaaacgtatgccggcgggcggctgggtctgtttgtgttctcgcaggaaatggtc
tatttctcagacctcaaatacgaatgccgagatgtctaa

DBGET integrated database retrieval system