KEGG   Felis catus (domestic cat): 101100604Help
Entry
101100604         CDS       T02385                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101100604 (ENTPD2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101100604 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 501 aa AA seqDB search
MAGKVLSLLPPLLLAAAGLAGLLLLCVPTRDIWELPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCNVRGGGISSYADDPSRAGQSLVECLDQALQEVPKESHVHTPLYLG
ATAGMRLLNLTSPEASANVLAAVTRTLTRYPFDFRGAHILSGQDEGVFGWVTANYLLENF
IKYGWVGRWFRPRKGTLGAMDLGGASTQITFETASPAEDPANEVRLRLYGQHYCVYTHSF
LCYGRDQVLRRLLAGALQTHGFHPCWPRGYSTQVLLQDVYESPCTAAQRPQTFNSSTRVS
LAGSSDPALCRGLILGLFNFSSCRFSRCSFNGIFQPPVAGNFMAFSAFFYTVDFLRSVMG
LPVATLQQLETAVVAVCNQTWSQLQAKAPGQRARLPDYCAGAMFVQQLLSRGYGFDERAF
GGCVAWSSCGVAEPTQTPCPLSLLRPAVPLRHLQICISDPSKIGAGPWPGIGLGVGVRAG
SVEVVEIVGKAAVWLQSVLEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaaggtgctgtcgctgctgccgccgttgctgctggccgcggcgggcctcgcc
gggctcctactgctgtgcgtccccactcgagacatctgggagctgcccgccctcaagtac
ggcattgtcctggacgcgggctcttcgcacacgtccatgttcatctacaagtggcctgca
gacaaggagaatgacacgggcatcgtgggccagcacagctcctgtaatgtacgcggagga
ggcatctctagctatgcagacgacccttccagggctggccagagtctcgttgaatgcctg
gaccaggcgcttcaggaggtgcccaaggagagccatgtgcacacgcccctctacctggga
gccacagcaggcatgcgcctgctcaacctgaccagtcccgaggcctcggccaatgtgctc
gcggctgtgacccggacgctgacccggtatcccttcgatttccgtggtgcccacatcctc
tcgggccaggacgagggggtgttcggctgggtgacggccaactacctgctggagaacttc
atcaagtatggctgggtgggccggtggttccggccaaggaaggggacgctgggggccatg
gacctggggggcgcctctacacagatcaccttcgagacggccagcccagccgaggatcca
gccaatgaggtccggctgcggctctatggccagcactactgcgtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccggaggctgctggctggtgcactccagacccac
ggcttccacccttgctggccgaggggctattctacccaagtgctgcttcaggacgtgtat
gagtctccgtgtaccgcggcccagcggccccagaccttcaacagcagcacccgggtcagc
ctggcagggagcagcgaccctgccctctgccgtggcctcatcttaggactcttcaatttc
tcctcctgccgcttctcccgatgttcctttaatggcatcttccagcccccagtggctggg
aacttcatggccttctctgctttcttctacaccgtggacttcctaaggtctgtgatgggg
cttcccgtggcaaccctgcagcagctggagacagccgtagtcgccgtctgcaaccagacg
tggagtcagctgcaggctaaggctccagggcagcgggcccgcctgcccgactactgcgcg
ggggccatgttcgtgcagcagctgctgagccgcggctacggcttcgacgagcgcgccttc
ggagggtgtgtggcctggagtagctgtggggtggccgagccaacacagaccccgtgtccc
ctgagtcttctccggccagcagtgcccctgcggcacctccagatctgcatcagtgaccca
agcaagattggagctgggccctggcctggaattggcctgggggtgggggtgagggcgggg
agcgtggaggtggtggaaatagtgggcaaggcagctgtctggctgcagtcagtgctggaa
gagtga

DBGET integrated database retrieval system