KEGG   Felis catus (domestic cat): 101100618Help
Entry
101100618         CDS       T02385                                 

Gene name
NSD1
Definition
nuclear receptor binding SET domain protein 1
Orthology
K15588  
histone-lysine N-methyltransferase NSD1 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101100618 (NSD1)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101100618 (NSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 2701 aa AA seqDB search
MDQTCELPRRNCLLPFSNPVNLDAPEDKDSPFGNGQSNFSEPLNGCTMQLSTASGTSQNA
YGQDSPSCYIPLRRLQDLASMINVEYLNGSADGSESFQDPEKSDSRAQSPVVCTSLSPGG
PTALAMKQEPSCNNSPELQVKVTKTIKNGFLHFENFTCVDDADVDSEMDPEQPVTEDESI
EEIFEETQTNATCNYEPKSENGVDVAMGNEQDSTSESRNGAVKSPFLPLAPQTETQKNKQ
RNEVDGSNEKAALLPAPFSLGDTNVTIEEQLNSINLSFQDDPDSSTSTLGNMLELPGTSS
SSTSQELPFCQPKKKSTPLKYEVGDLIWAKFKRRPWWPCRICSDPLINTHSKMKVSNRRP
YRQYYVEAFGDPSERAWVAGKAIVMFEGRHQFEELPVLRRRGKQKEKGYRHKVPQKILSK
WEASVGLAEQYDVPKGSKNRRCVTSSIKLDSEEDMPFEDCTNDPESEHDLLLNGCLKSLA
FDSEHSADEKEKPCAKSRARKSSDNPKRTSMKKGHIQFEAHKEERRGKIPENLGLNFISG
DVSDKQASNELSRIANSLTGSSTAPGNFLFSSCAKNTAKKEFETSNCDSLLGLSEGALIS
KHSGEKKKLQRGLVCSSKVQLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIDHSSESDN
SVLEITDAFDRTENILSVQKNEKVKYTRYPATNTKVKAKQKSLITNSHTDHLMDCTKTGE
PGTETSQVNLSDLKVSTLIRKPQSEFRNDGFSPKFNTPSSISSENSLIKGGATSQALLHS
KSKQPKIRSIKCKHKENPVVVESSVTNEDCSLKCCSSDTKGSPLASISKSGKVDGLKLLS
NMHEKTRDSNDIETAVVKHVLSELKELSYRSLSEDVSDSGTSKPSKPLLFSPASGQNHIP
IEPDYKFSTLLMMLKDMHDSKTKEQRLMTAQNLVSYRSPGLGDCSTSSPVAASKALVSGS
STYNSEKNGDGTQNPVRPSPSGGDSALSGELSVSVPSLVSDRRDLPASGKSRANCVTRRN
CGRSKPSSKLRDSFSSQMGKNTLNRKALKTERKRKLNRLPAVTLETALQGDRPSGGSENG
CSRGGLEDPGKEEPLQLMGHLTSEDSAHFSSVNFDDKVNQSNPDKIPEKGPSFENRKGPE
LDTEVNSENDEPNGVNQAVPKKRWQRLNQRRTKPRKRTNRFREKENSEGAFGVLLPADPV
KKGDEFPEHRPPTSTNILEDALADPNHASCLDSVGPRLNVCDKSSASIEEMEKEPGIPNL
TPQPELPEPAMRSEKKRLRKPSKWLLEYTEEYDQIFAPKKKQKKVQEQVHKVSSRCEEES
LLARCRSSAQNKRVDENSLISTKEEPPVLEREAPFLEGPLAQSELGGGHAELPQLTLSVP
VAPEVSPRPALESEELLVKTPGNYESKRQRKPTKKLLESNDLDPGFMPKKGDLGLSKKCY
EAGHLENDINESRAASHSKEFGGGTTKIFDKPRKRKRQRHSTAKVHCKKMKNDDSSKETP
ISEGELMTHRTAASPKDTVEEGVENDHGMPASKKLQGERGGGAALKENVCQNCEKLGELL
LCEAQCCGAFHLECLGLTEMPRGKFICNECRTGIHTCFVCKQSGEDVKRCLLPLCGKFYH
EECVQKYPPTVMQNKGFRCSLHICITCHAANPASVSASKGRLMRCVRCPVAYHANDFCLA
AGSKILASNSIICPNHFTPRRGCRNHEHVNVSWCFVCSEGGSLLCCDSCPAAFHRECLNI
DIPEGNWYCNDCKAGKKPHYREIVWVKVGRYRWWPAEICHPRAVPSNIDKMRHDVGEFPV
LFFGSNDYLWTHQARVFPYMEGDVSSKDKMGKGVDGTYKKALQEAAARFEELKAQKELRQ
LQEDRKNDKKPPPYKHIKVNRPIGRVQIFTADLSEIPRCNCKATDDNPCGIDSECINRML
LYECHPTVCPAGGRCQNQCFTKRQYPEVEIFRTLQRGWGLRTKTDIKKGEFVNEYVGELI
DEEECRARIRYAQEHDITNFYMLTLDKDRIIDAGPKGNYARFMNHCCQPNCETQKWSVNG
DTRVGLFALSDIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGFLGVRPKNQPIATEEKS
KKFKKKQQGKRRTQGEITKEREDECFSCGDAGQLVSCKKPGCPKVYHADCLNLTKRPAGK
WECPWHQCDICGKEAASFCEMCPSSFCKQHREGMLFISKLDGRLSCTEHDPCGPNPLEPG
EIREYVPPPVPLPPGPGTHLAEHSSGVAAQGPKMLDKLPADTNQTLSLSKKALAGTCQRP
PLPERPPDRTDSRPQPVDRVRDLAGSGTKPQSLVSSQKPLDRPPAVAGPRPQLSDKPSPV
TGISSSPSVRSQPLERPLGTADPRLDKSIGAASPRPQSLEKAPVPTGLRLPPPDRLLVTS
GPKPQTSDRPPDKSHASLSQRLPPPDKVLSAVVQTLVAKEKALRPVDQNTQSKNRAALVM
DLMDLTPHQKERAASPHEVTSQIDEKMPVLESSSWTASKGLGQMPRAVERGSVADPILQP
PGKAAVPSEHPWQAVKSLTQARLLSQAPAKAFLYEPTTPASGRASAGVEQTPGPPSQAPG
LMKQVKQMAGGQQLPGLAAKNGQSFRPLGKAPSSLCTEEKKLATAEQSPWALGKASPGPG
LWPIVAGQTISPSCWSSGSTQTLAQTCWSLGRGQDPKPEQNTLPALNQAPSSHKCAESEQ
K
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacctgtgaactacctagaagaaattgtctgctgcccttttccaatccagtg
aatttagatgcccctgaagacaaggacagccctttcggtaatggtcaatccaatttttct
gagccacttaatgggtgtactatgcagttatcgactgccagtggaacatcccaaaatgct
tatggacaagattctccatcttgttacattccactgcggagactacaggatttggcctcc
atgatcaatgtagagtatttaaatgggtctgctgatggatcagaatcctttcaagaccct
gaaaaaagtgattcaagagctcagtcgccagttgtttgcacttccttgagtcctggtggt
ccaacagcacttgctatgaaacaggaaccctcttgtaataactcccctgaactccaggta
aaagtaacaaagactatcaagaatggctttctgcactttgagaattttacttgtgtggac
gatgcagatgtagattctgaaatggacccagaacagccagtcacagaggatgagagtata
gaggagatctttgaggaaactcagaccaatgccacctgcaattatgagcctaaatcagag
aatggtgtagacgtggccatgggaaatgaacaagacagcacatcagagagtagaaatggt
gcagtcaaatcgccattcttgccattagctcctcaaactgaaacacagaaaaataagcaa
agaaatgaagtggacggcagcaatgaaaaagcagcccttctcccagcccccttttcacta
ggagatacaaacgttaccatagaagagcaattaaattcaataaatttatcttttcaggat
gatccagattccagtaccagtacattaggaaacatgctagaattacctggaacttcatca
tcatctacttcacaggaattgccattttgtcaacccaagaaaaagtctacgccattgaag
tatgaagttggagatctcatctgggcaaaattcaagagacgcccatggtggccctgcagg
atttgttctgatccgttgattaacacacattcaaaaatgaaagtttcaaaccggaggccc
tatcgacagtactacgtggaggcttttggggacccttcagagagagcctgggtggctgga
aaagcaatcgtcatgtttgaaggcagacatcaatttgaagagctacctgttcttaggaga
agaggaaagcagaaagaaaaaggatataggcataaggttcctcagaaaattttgagtaaa
tgggaagccagtgttggtcttgctgaacagtatgatgttcccaaagggtcgaagaaccga
agatgtgtcaccagttcaatcaagttggacagtgaggaggacatgccatttgaggactgt
acaaatgatcctgaatcagaacatgacctgttacttaatggctgcttgaaatctctggct
tttgactcagaacattctgcagatgagaaggaaaagccttgtgctaagtctcgagccaga
aagagttctgataatccaaaaaggactagtatgaaaaagggccacatacaatttgaagca
cataaggaagaacgaaggggaaagattccagagaaccttggcctaaactttatttctggg
gatgtatctgataagcaggcctctaatgaactttccaggatagcaaacagcctcacaggg
tccagcactgccccaggaaatttcctgttttcttcttgtgcaaaaaacactgcaaagaaa
gaatttgagacttcaaattgtgactctttactgggcttgtctgagggtgccttgatctct
aaacattctggggaaaagaaaaaactccaaagaggtttggtgtgtagttcgaaagtacag
ctctgttatattggagcaggtgatgaagaaaagcgcagtgattccattagtatctgtacc
acttctgatgatggaagcagtgatctggatcccatagatcatagttcagaatctgataac
agtgtccttgaaattacagatgcttttgatagaacagagaacattttatctgtgcagaaa
aatgaaaaggtaaagtatactaggtatcctgccacaaacactaaggtaaaagcaaagcag
aagtccctcattactaattcacatacagaccacttaatggattgtactaagacaggagaa
cctggaactgagacatctcaggttaatctctctgatcttaaagtgtctactcttatccgc
aaaccccaatcagagtttagaaatgatggtttctctccaaaattcaacacaccatcaagc
atttccagtgagaattccctaataaaaggtggggctacaagtcaagctctgttacattca
aaaagcaaacagcccaagatccgaagtataaagtgcaaacataaagaaaatccagttgta
gtggaatcttcagttacaaatgaggactgcagtttgaaatgctgctcttctgatactaaa
ggctctcctttggccagcatttccaaaagtgggaaagtggatgggctaaaactactgagc
aacatgcatgagaaaaccagggattcaaatgacatagaaacagcagtggtgaaacacgtt
ctgtcagagttgaaggaactctcttatagatccttaagtgaagatgtcagtgactctgga
acatcaaagccatcaaaaccattactcttttctcctgcctctggtcagaatcatatacct
attgaaccagactacaaattcagtacattattaatgatgttgaaagatatgcatgatagt
aagaccaaggagcaacgcttaatgactgctcaaaacttggtttcctatcggagtcctggt
cttggggactgttctaccagtagtcctgtagctgcttctaaggccttggtttcaggaagc
tccacttacaattcagaaaaaaatggagatggcactcagaacccagtccgtcctagccct
agtgggggtgactctgcactgtctggggagttgtctgtatctgtccccagcttagtgtct
gacagaagagacctccctgcttctggtaaaagtcgtgcaaactgtgttactaggcgcaac
tgtgggcgatcaaaaccttcatctaaattgcgagatagtttttcatcccagatgggaaag
aacacattaaaccgtaaagccttaaagacagagcgcaaaagaaaactgaaccgacttcca
gctgtgactcttgagactgcactgcagggagacagaccaagtgggggttcagagaatggc
tgctcaagaggtggactagaagaccctggtaaagaagaaccccttcagttaatgggtcat
ttaacaagtgaagacagtgcccatttttccagtgttaattttgatgacaaagtcaaccag
tctaaccctgataaaattcctgaaaaaggcccctcttttgaaaacagaaaaggcccagag
ttggatactgaagtgaacagtgagaatgatgaacccaatggtgtaaatcaagcggtgcct
aaaaagcggtggcagcgtttaaaccaaaggcgcactaaacctcgtaagcgcactaacaga
tttagggagaaagaaaactctgagggtgcctttggggttttgcttccagctgacccggta
aagaagggggatgagttcccagagcatagaccccctacttcgacaaacatactagaagat
gccctggcagatccaaatcatgctagctgcttagattcagttgggccacggttgaatgtt
tgtgataaatccagtgccagcattgaggaaatggaaaaagagccaggaattcccaatttg
actccccagcctgagctccctgaaccagctatgcggtcagagaagaagcgtcttaggaag
ccaagcaagtggcttctggaatatacagaagaatatgatcagatatttgctcctaagaaa
aaacaaaagaaggtgcaggaacaggtgcacaaggtaagttcccgctgtgaagaggaaagc
cttttagcccgatgtcgatctagtgctcagaacaagcgggtggatgagaattctttgatt
tcaaccaaagaagagcctccagttcttgaaagggaggctccgtttttggaagggcccttg
gctcagtcagaacttggaggtggacatgctgagttgccacagctgaccttgtctgtgcct
gtggctccggaagtctctccacggcctgcccttgagtctgaggaattgctagttaaaaca
ccaggaaattatgaaagtaaacgtcagagaaaaccaactaagaaacttcttgaatccaat
gatttagaccctggatttatgcctaagaaaggggatcttggtctttctaaaaagtgttat
gaagctggccacttggagaatgacattaatgaatcacgtgctgcatctcattctaaagag
tttggtggaggcactacgaagatatttgataaaccaaggaagcgaaaacgacagaggcat
tctacagccaaggtgcattgtaaaaaaatgaaaaatgacgactcatcaaaagaaactcca
atctcagagggagaactgatgacacacagaacagctgcaagccccaaggacactgttgag
gagggtgtagagaatgatcatgggatgccagcatcgaaaaagctgcagggcgaacgaggc
ggaggagctgcactcaaggagaatgtctgtcagaactgtgagaaactgggtgagctgctg
ttatgtgaggctcagtgctgtggggctttccacctggagtgccttggactaactgagatg
ccgagaggaaaatttatctgcaatgaatgtcgcacaggaatccatacctgttttgtttgt
aagcagagtggggaagatgttaaaaggtgccttttgcccttgtgtggaaagttttaccat
gaagagtgtgtccagaagtatccacccactgttatgcagaacaagggcttccggtgctcc
ctccacatctgtataacctgccatgctgctaatccagccagtgtttctgcatctaaaggt
cgtctgatgcgctgtgtccgctgccctgtggcataccatgccaatgacttttgcctggct
gctgggtccaagatccttgcatctaatagtatcatctgccctaatcactttacacctcgg
cggggctgccgaaatcatgagcatgttaacgttagctggtgttttgtatgctcagaagga
ggcagccttctgtgctgtgattcttgccctgctgcttttcatcgtgaatgcctgaacatt
gatatccctgaaggaaactggtattgcaatgattgtaaggcaggcaaaaagccccattac
agggaaattgtctgggtaaaagttggacgatacaggtggtggccagctgagatctgccat
cctcgagctgtaccttccaatatcgataagatgagacatgatgttggcgagttccctgtg
ttattctttgggtctaatgactatctgtggacacaccaggctcgagtctttccctatatg
gagggtgatgtgagcagcaaggataagatgggcaaaggagtggatgggacatataaaaaa
gctcttcaagaagctgcagcaaggtttgaggagttaaaggcacaaaaagagctaaggcag
ctgcaggaagaccgaaagaatgacaagaagccaccaccttacaagcatataaaggtgaac
cgtcctattggcagggtacagatctttactgcagacttgtctgaaattccccgttgcaac
tgtaaagctactgatgataacccctgtgggatagactccgagtgtatcaaccgcatgctg
ctctatgagtgccaccccacagtatgtcctgccggaggacgctgccaaaaccagtgcttc
actaagcgccagtatccagaggttgaaatttttcgcacattacagaggggctggggtctc
cggacaaaaaccgatattaaaaagggtgaatttgtgaatgagtatgtgggtgagctaata
gatgaagaagaatgcagagctcgaatccgttatgcccaagaacatgatatcactaatttc
tatatgcttaccctagacaaagaccgaatcattgacgctggtcccaaaggaaattatgct
cggttcatgaatcattgctgccagcccaactgtgaaacacagaaatggtctgtgaatgga
gatacccgtgttggtctttttgccctgagtgacattaaagcaggcactgaacttaccttc
aactacaacctagaatgtcttgggaatggaaagactgtttgcaaatgtggagccccaaac
tgcagtggctttttgggtgtaaggccaaagaatcaacccattgccacggaagaaaagtca
aagaaattcaagaagaagcaacaggggaagcgcaggacccagggtgaaatcacaaaggaa
agagaggatgagtgtttcagctgtggggatgctggccagctcgtctcttgcaagaagcca
ggctgcccaaaagtttaccacgctgactgtctcaatctaaccaagcgaccagcagggaaa
tgggagtgtccttggcatcagtgtgacatctgtgggaaggaagcagcctccttctgtgag
atgtgtcccagttccttttgtaagcagcatcgggaagggatgctcttcatctccaagttg
gatgggcgtttgtcttgtactgagcatgacccctgcgggcccaaccctctggaacctggg
gagatccgtgagtatgtgcctcccccagtaccgctgcctccaggcccaggcactcacctg
gcagaacattcatcaggagtggctgctcaggggcccaagatgttggataagctgcctgct
gacaccaaccagacactgtcactgtccaaaaaagctctggcaggaacttgtcagaggcca
ccgctgcctgaaagacctcctgacagaactgactccaggccccagcctgtagatagggtc
agggaccttgctgggtcggggaccaaaccccaatccttggtatccagccagaagccactg
gacaggccacctgcagtggcaggaccaagaccccaactatctgacaaaccctctccagtg
accggcataagctcctcaccctcagtcaggtcccaaccactggaaagacctctggggaca
gctgacccaaggctggataaatccataggtgctgccagcccaaggccccagtcactggag
aaagccccagtccctactggtctaagacttccacctccagacagactgctagtcaccagt
ggtcccaaaccccagacttcagacaggcccccggacaaatcccatgcttctttgtcccag
agactcccacctcctgacaaagtactatcagctgtggtccagaccctggtagctaaagaa
aaagcactgaggcccgtggaccagaatactcagtcaaaaaatagagctgctttggtaatg
gatctcatggacctaactcctcaccagaaagaacgggctgcttcacctcatgaggtcaca
tcacagattgatgagaagatgccggtgttggaatcaagctcatggactgccagcaaaggt
ctagggcagatgccgagagctgtagagagaggcagtgtggcagatcctatcctgcagcca
ccagggaaagcagcagtcccttcggagcacccctggcaagcggttaaatcactcacccag
gccagacttctctctcaggctcctgccaaggcttttttatatgagccaacaactccggcc
tcaggaagagcatctgcgggggtggagcagacaccagggcctcccagtcaagcaccaggc
ctgatgaagcaggtgaagcagatggctggaggccagcaactacctggacttgctgccaag
aatgggcaatccttcaggcctcttgggaaggccccatcctccctctgtactgaagagaag
aagttggcaaccgcagagcagagtccctgggccctgggaaaggcctcaccagggccaggg
ctctggcccatagtggctggacagacaatatcaccgtcttgctggtcctctgggagcaca
cagacattggcacagacttgctggtctcttggaagagggcaagaccctaaaccagagcaa
aatacacttccagctcttaaccaggctccttccagtcacaagtgtgcagagtcagaacag
aaataa

DBGET integrated database retrieval system