KEGG   Felis catus (domestic cat): 101100824Help
Entry
101100824         CDS       T02385                                 

Definition
(RefSeq) glutathione S-transferase Mu 4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00480  Glutathione metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01524  Platinum drug resistance
fca05200  Pathways in cancer
fca05204  Chemical carcinogenesis
fca05225  Hepatocellular carcinoma
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101100824
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101100824
   00982 Drug metabolism - cytochrome P450
    101100824
   00983 Drug metabolism - other enzymes
    101100824
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101100824
   05204 Chemical carcinogenesis
    101100824
   05225 Hepatocellular carcinoma
    101100824
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101100824
  Drug resistance
   01524 Platinum drug resistance
    101100824
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101100824
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101100824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_C GST_C_6
Motif
Other DBs
NCBI-GeneID: 101100824
NCBI-ProteinID: XP_023113605
Ensembl: ENSFCAG00000015598
Position
C1
AA seq 245 aa AA seqDB search
MSREKFSDRPESWASWASRTDYLQQRKAGCQDFSDVFLGFPSQRAHAIRLLLAYTDSHYE
GKKYTMGDALDYDRSQWLDEKFKLGLDFPNLPYLIDGAHNIILCYIARKHNLCGETEEEM
MIHVDILENQATDASNRLTRVCYSPDFERLKPVYLESIPGEMKLYSQFLGKRPWFAGEKI
PCLDCLAYDILDLHCIFEPKSLDAFPNLKEFIARIEGLKKISAYMKSSRFLPGPLFLKIA
FWGSK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtccagggagaagttttcagacaggcccgaatcctgggcctcctgggcctcccggaca
gattatctgcagcagagaaaagcaggatgtcaggacttctctgatgtcttcctcgggttt
ccctcccagcgggctcacgccatccgcctgctcctggcctacacagactcacactatgag
ggaaagaagtacacgatgggggatgctctggactatgacagaagccagtggctggatgaa
aaattcaagctgggcctggactttcccaatctgccctacttaattgatggggctcacaat
atcatcctttgctacattgcccgcaaacacaacctgtgtggggagacagaagaggagatg
atgatacatgtggatattttggagaaccaagctacagacgcctctaatcggctcaccagg
gtctgctacagccctgactttgagagactgaagcctgtgtatctggagtccatcccaggt
gagatgaagctgtactcacagtttctggggaagaggccttggtttgcaggggagaagatc
ccctgtttggattgcctggcttatgacatccttgacctgcactgcatatttgagcccaag
tctctggatgcattccccaacctgaaagagttcatagcccgcattgagggcctgaagaag
atctctgcctacatgaagtccagccgcttcctcccaggccctctgtttctaaagatcgcc
ttttggggcagcaagtag

DBGET integrated database retrieval system