KEGG   Felis catus (domestic cat): 101100941Help
Entry
101100941         CDS       T02385                                 

Gene name
HDAC3
Definition
(RefSeq) histone deacetylase 3 isoform X3
  KO
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Human papillomavirus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101100941 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101100941 (HDAC3)
  Substance dependence
   05034 Alcoholism
    101100941 (HDAC3)
  Infectious diseases
   05165 Human papillomavirus infection
    101100941 (HDAC3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101100941 (HDAC3)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101100941 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A1
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccctgacgtgggcaacttccactacggggca
gggcaccctatgaagccccatcgcttggcattgacccatagtctggtcctgcactacggt
ctctataagaagatgatcgtcttcaagccgtaccaggcttcccagcatgacatgtgccgc
tttcactctgaggactacatcgacttcttgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaacgtgggcgatgactgcccagtgtttcccgggctc
tttgagttctgttcccgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaaatttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgatattgacatccaccacggtgatggagttcaggaagcc
ttctacctcactgaccgggtcatgacagtctccttccacaaatatggaaactacttcttt
cctggcacaggtgacatgtatgaagttggagcagagagtggccgctactactgtctaaat
gtgcccttgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgtctaggctgcttcaacctcagcattcgagggcatggggaatgcgtc
gaatatgtcaagagcttcaatatccctcttctggtgctaggtggtggtggctatactgtc
cgaaatgttgcccgctgctggacgtatgaaacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtattttgccccggacttcacactccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtacctggaccagatccgccag
acaatctttgaaaacttgaagatgctgaaccatgcacctagcgtccagattcatgatgtg
cctgcagaccttctgacctatgacaggactgacgaggctgatgcagaggagaggggtcct
gaagagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgacgtggagatttaa

DBGET integrated database retrieval system