KEGG   Felis catus (domestic cat): 101100941Help
Entry
101100941         CDS       T02385                                 

Gene name
HDAC3
Definition
histone deacetylase 3
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101100941 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101100941 (HDAC3)
  Substance dependence
   05034 Alcoholism
    101100941 (HDAC3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101100941 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A1
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccctgacgtgggcaacttccactacggggca
gggcaccctatgaagccccatcgcttggcattgacccatagtctggtcctgcactacggt
ctctataagaagatgatcgtcttcaagccgtaccaggcttcccagcatgacatgtgccgc
tttcactctgaggactacatcgacttcttgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagccttaatgccttcaacgtgggcgatgactgcccagtgtttcccgggctc
tttgagttctgttcccgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaaatttgag
gcctctggcttctgctatgtcaatgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgatattgacatccaccacggtgatggagttcaggaagcc
ttctacctcactgaccgggtcatgacagtctccttccacaaatatggaaactacttcttt
cctggcacaggtgacatgtatgaagttggagcagagagtggccgctactactgtctaaat
gtgcccttgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgtctaggctgcttcaacctcagcattcgagggcatggggaatgcgtc
gaatatgtcaagagcttcaatatccctcttctggtgctaggtggtggtggctatactgtc
cgaaatgttgcccgctgctggacgtatgaaacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtattttgccccggacttcacactccatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtacctggaccagatccgccag
acaatctttgaaaacttgaagatgctgaaccatgcacctagcgtccagattcatgatgtg
cctgcagaccttctgacctatgacaggactgacgaggctgatgcagaggagaggggtcct
gaagagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgacgtggagatttaa

DBGET integrated database retrieval system