KEGG   Felis catus (domestic cat): 101100947Help
Entry
101100947         CDS       T02385                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  
cytochrome c
Organism
fca  Felis catus (domestic cat)
Pathway
Sulfur metabolism
Metabolic pathways
Platinum drug resistance
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    101100947
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101100947
   04215 Apoptosis - multiple species
    101100947
   04115 p53 signaling pathway
    101100947
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101100947
   05210 Colorectal cancer
    101100947
   05222 Small cell lung cancer
    101100947
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101100947
   05012 Parkinson's disease
    101100947
   05014 Amyotrophic lateral sclerosis (ALS)
    101100947
   05016 Huntington's disease
    101100947
  Cardiovascular diseases
   05416 Viral myocarditis
    101100947
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100947
  Infectious diseases
   05134 Legionellosis
    101100947
   05152 Tuberculosis
    101100947
   05164 Influenza A
    101100947
   05161 Hepatitis B
    101100947
   05168 Herpes simplex infection
    101100947
   05145 Toxoplasmosis
    101100947
  Antineoplastic resistance
   01524 Platinum drug resistance
    101100947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 105 aa AA seqDB search
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKAGERADLIAYLKKATKE
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccacggtttatttgggcgaaag
acaggccaagcccctgggttttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaaggcaggggaaagagcagacttgatagcttatctcaaa
aaagctactaaggagtaa

DBGET integrated database retrieval system