KEGG   Felis catus (domestic cat): 101101114Help
Entry
101101114         CDS       T02385                                 

Gene name
GK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101101114 (GK)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101101114 (GK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     101101114 (GK)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101101114 (GK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 553 aa AA seqDB search
MAAAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVENLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGANGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKVLPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCVFSEHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSVGWVTTQSSESGDPSIFCSLPLGFFIVSSM
VMLIGARYISGIP
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgaagaaagcagttttggggccattggtgggggcagtggaccagggcacc
agctccacgcgctttttggtcttcaattcaaaaacagctgaactacttagtcatcatcaa
gtggaaatcaaacaagagtttccaagagaaggatgggtggaacaagacccaaaggaaatt
ctgcagtctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatatt
gacatttccaacataaaagctattggtgtcagtaaccagagggaaaccactgtagtctgg
gacaagctaactggagagcctctctacaacgctgtggtgtggcttgatctaagaacccag
tctaccgttgagaatcttagtaaaagaattccaggaaataataactttgtcaagtccaag
acaggccttccacttagcacttacttcagtgccgtgaaacttcgttggctccttgacaat
gtgagaaaagttcaaaaggctgttgaagaggatagagctctttttgggaccattgattca
tggcttatttggagtttgacgggaggggccaacggaggtgtccattgcacggatgtaacc
aatgcaagtaggacgatgcttttcaacattcattctctggagtgggataaagagctctgc
gaattttttgaaattccaatgaaagttcttccaaatgttcggagttcttctgagatctat
ggcttaatgaaagctggggccttggaaggtgtgccaatatcggggtgtttgggggaccag
tctgctgcattggtgggacaaatgtgcttccaggatggacaagccaaaaatacgtatgga
acaggctgcttcttactgtgtaatacaggccgtaagtgtgtgttttctgaacacggcctt
ctgaccacagtggcttacaagcttggcagagacaagccggtgtattacgcgttggaaggt
tctgtagccatagctggtgctgttattcgctggctaagggataatcttggaattataaag
agctcagaggaaatcgaaaaacttgctaaagaagtaggtacttcttacggctgctatttc
gtccctgcgttttcagggctgtatgcgccttactgggagcccagtgccagagggatcatc
tgtggactcactcagttcaccaataaatgccatattgcttttgctgcattagaagctgtt
tgtttccaaacccgggagattttggatgccatgaaccgcgactgtggaataccactcagc
cacctgcaggtagacggagggatgaccaacaacaaaatccttatgcagctacaagcagac
attctgtacatcccagtagtgaagccctcgatgcccgaaacgaccgccctgggagccgcc
atggcagcgggggctgcggaaggagttggcgtttggagcctcgagcccgaggatttgtca
gcggttacgatggagcggtttgaaccccagatcaatgctgaggaaagtgaaattcggtac
tctacgtggaagaaagctgtgatgaagtcagtgggttgggttacaactcagtcttcggaa
agtggtgaccctagtatcttctgtagtctacccttgggcttttttatagtgagtagcatg
gtaatgttaatcggagcaaggtacatctcaggtatcccataa

DBGET integrated database retrieval system