KEGG   Felis catus (domestic cat): 101101194Help
Entry
101101194         CDS       T02385                                 

Gene name
DOT1L
Definition
DOT1-like histone H3K79 methyltransferase
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101101194 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101101194 (DOT1L)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101101194 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1354 aa AA seqDB search
MTLAALDSLLPLLREFTRFHMTAFPFSVLGPRTCRVVLARRPRHRSQPRPPGSVVKPGLR
GAVTAAEQLFAALNLTSRHRARLLCAAADGETEAWRCSVAQNQARGFQADKHHDAAHEII
ETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKL
NTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDL
FVDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTL
ERGDFLSEEWRERIANTSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFR
INSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQ
EAARRRQQRENKSNTTTPTKVPESKAAVAADTPVDSGAEEEKAGTTAIKKPSPSKARKKK
LNKKGPLLAATPPALQKLLESFKIQYLQFLAYTKTAQYKASLQQLLDQEKEKNARLLGAA
QQLFGHCQAQKEEIKRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQTEQLQEDN
RELRSQSLQLLKARCEELKLDWSTLSLENLLKEKQALRSQISEKQRHCLELQISIVELEK
SQRQQELLQLKSCVPPDDALSAHLRGKGALGREPEADPGRLHLDLDCSRFSLPHFSSASP
ELSMNGHAAGYELCGALSRPPSKQNTPQYLASPLDQEVVPCTPSHGSRPRLEKVSGLALP
DYTRLSPAKLVLRRHLSQDHAAGGKTAAGELHPRAEHAKENGLPYQSPGIANGIKLSPQD
PRPSSPVALQMTGERGSEKGLKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVV
LPSRAEKVRSTPSPVPQTRESLSTLEKQMGANAHSAGSKSLAPAPAGFYAGSVAVSPAPL
ASGADPGTFDEVPSAGGLFASVGSCGSTPQHPPLLPQPRGSGAASPAHPLCASPRLGGAA
QGPLPDANKGDLPPEAGFSDPEGEAKRRIVFTVSAGGGSTKQSPPSKPSPLPTGGRGDGS
QGHGQDSRKRGRRKRAAAGTPGLSSGVSPKRRALPSVAGLFTQSSGSPLNLNSMVSNINQ
PLEITAISSPESLKSSPVPYQDSDQPPVLKKEKPLSQTNGAHYSPLTSDEEQGSEDEPGS
TRIERKIATISLESRSPPKTLENGGGLAGRKPTPAGEPANSSKWKSTFSPISDLGLAKCA
DSPLLTNSHAMGSFPSGVAGGAVGGKARAQPGGPYETLNCLSFLPQRVDGPAGLRGGAQG
TQAVLPRVETVGSERCKGKPGKPGLAVCTSLQDG
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggcggcgttggattctctgctgccgctgctgcgtgaattcacgcgtttccac
atgacagccttccccttctcggtgctcgggccccgcacgtgccgcgtcgtgctggcccgc
cgtcctcgccaccgctcacagccccggcccccagggtctgttgtaaagcctggcctgaga
ggtgcggtcactgccgcagagcagctgttcgcggctctgaacctgacctctcggcaccgc
gcacgccttctctgtgccgctgcagatggggaaacagaggcctggagatgttcggtagct
caaaaccaggcccgcggcttccaggctgacaaacaccacgatgctgctcacgaaatcatc
gagaccatccggtgggtctgcgaagagatcccggacctcaagctcgctatggagaactac
gttttaatcgactacgacaccaaaagcttcgagagcatgcagaggctctgtgataagtac
aaccgcgccatcgacagcatccaccagctgtggaaggggaccactcagcccatgaaactg
aacacccggccgtccaacgggctcctgcgccacatcctgcagcaggtgtataaccactcg
gtgacggaccccgagaagctcaacaactacgagcccttctccccggaggtgtacggggag
acctcctttgacctggtcgcgcagatgatcgacgagatcaagatgaccgaggacgacctg
tttgtggacctgggcagcggagtgggccaggtcgtgctccaggtggccgcggccaccaac
tgcaaacatcactacggcgtggagaaagccgacatcccagccaagtacgcggagaccatg
gaccgagagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacactg
gaaagaggcgacttcctctcggaggagtggagagagcggattgccaacacaagtgttata
tttgtgaataactttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcg
aacatgaaggaaggcggcagaattgtgtcctcgaagccctttgcgcctctgaacttcaga
ataaacagcagaaacttgagcgacatcggcaccatcatgcgcgtcgtggagctctcgccc
ctgaagggctctgtgtcctggacggggaagccggtctcctactacctgcacaccatcgac
cgcaccatacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggagcag
gaggcggctcggcgccggcagcagcgggagaacaagagcaacacgaccactcccaccaag
gtgcccgagagcaaggccgccgtggccgcggacacccccgtggattccggtgccgaggaa
gagaaggctgggacgaccgccatcaaaaagccgtccccctccaaagcccggaagaagaag
ctgaacaagaaggggccgctgctggcagccaccccgcccgcactgcagaagctgctagaa
tccttcaagattcagtacttgcagttcttggcctacaccaagaccgcccagtacaaggcc
agccttcagcagctgctggaccaggagaaggagaagaacgcccggctgctgggggccgca
cagcagctgttcggccactgccaggcccagaaagaggagatcaagaggctcttccagcag
aaactggatgagctgggggtgaaggcgctgacctacaacgacctgattcaggcgcagaag
gagatctcggcccataaccagcagctgagggagcagacggagcagctgcaggaggacaac
agggagctgaggagccagagcctgcagctgctcaaggctcggtgtgaggagttgaagctg
gactggtccacgctgtcactggagaacctgctgaaggagaagcaggccctgaggagccag
atctccgagaagcagaggcactgcctggagctgcagatcagcatcgtggagctggagaag
agccagcggcagcaggagctcctgcagctcaagtcctgcgtgccgcccgacgacgccctg
tcggcgcacctgcgcgggaaaggcgccctgggccgggagccggaggcggaccccggccgg
ctgcacctcgacctggactgctctcggttctccctgccgcacttcagcagcgccagcccg
gaactctccatgaacggccacgcggccggctacgagctctgcggtgcgctgagccggccc
ccgtccaagcagaacaccccccagtacctggcctccccgctggaccaggaggtggtgccc
tgcacccccagccacggcagccggccaaggctcgagaaggtgtctggcctggccttgccg
gactacaccaggctttccccggccaagctggtgctgaggcggcacctcagccaggaccac
gcggccggcggcaagacggcggccggggagctgcacccgcgagccgagcacgccaaggag
aacggccttccgtaccagagcccgggcatcgccaacggcatcaagctgagccctcaggac
ccccggccctcatcccccgtggccttacagatgacaggggagaggggcagcgagaagggt
ttgaaggagcgtgcctacgccagcagcggggaggccatcaccagcctgcccgtcagcatc
ccgctcagcaccgtgcagcccagcaagctgcccgtcagcatccctctggccagcgtggtg
ctgcccagccgtgccgagaaagtgagaagcacccccagccccgtgccgcagacccgagag
tccttgtccacacttgaaaagcagatgggcgctaatgcacacagcgccggaagcaaaagt
ctcgccccagcccctgcaggcttctacgcgggctcggtggccgtcagcccagcccccctc
gcttccggagcagatcccggcacctttgacgaggtccccagcgcaggcggtctgtttgcc
agcgtggggtcctgtggctccaccccgcagcacccgcccctgctgccgcagccccgcggc
tctggcgcagcctcgcccgcccacccgctctgcgccagcccccgcctgggcggcgccgcc
cagggtccgctccctgacgccaacaaaggggaccttcctcccgaggccggcttctcggac
cccgagggcgaagccaagcggaggatcgtcttcaccgtctcggccggcgggggcagcacc
aagcagtcgcctcccagcaagcccagccctctgcccacgggcggccgtggggacggcagc
cagggccacgggcaggacagccgcaagcggggcagaaggaagcgggcggcggcagggacc
cccggcctgagctcaggcgtgtcgcccaagcgccgggccctgccgtccgtggccggcctc
ttcacgcagtcttcagggtcccccctgaacctcaactccatggttagcaacattaaccag
cctttggaaatcacggccatttcgtcccctgagagcctgaagagctcccctgtcccctac
caggacagcgaccagccgcccgtcctcaagaaggagaagcccctgagccagaccaacggg
gcccactactccccactgacctcggacgaggagcagggctccgaggatgagccgggcagc
accagaattgagagaaaaattgcgacaatctccttagaaagcagatctcccccgaaaacc
ttggaaaacggtggtggcctggcggggaggaagccgacccctgccggcgagcccgccaac
agcagcaagtggaagtctaccttttcgcccatctccgacctcggcctggccaagtgcgcc
gacagcccgctactgaccaactcgcacgccatgggcagctttccctccggggtggcaggc
ggcgcagttggaggtaaggctagagcccaaccagggggcccgtatgagaccctgaactgt
ctgtccttccttccacagagagtggacgggcccgcagggctccgaggaggggcccagggg
acccaggctgttctgcctcgggtggagacggtcggttctgagaggtgcaagggaaagcca
gggaaaccggggctggccgtgtgtaccagcctccaggacggctga

DBGET integrated database retrieval system