KEGG   Felis catus (domestic cat): 101101369Help
Entry
101101369         CDS       T02385                                 

Definition
(RefSeq) profilin-1-like
  KO
K05759  profilin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04810  Regulation of actin cytoskeleton
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101101369
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101101369
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101101369
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Others
    101101369
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     101101369
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101101369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 101101369
NCBI-ProteinID: XP_011290079
UniProt: M3WZU1
Position
X
AA seq 152 aa AA seqDB search
MQCIEDISEEVWQDCITLFLQTWMCCDAAIITNSPPWMLASYPEGNLFQLTQEEIQILLA
REGREKFLQGITLAGTKCLLIRDNLYTEGNNTMDLRTKGQSRCSQEVTVVQIESVYLVMM
GQKGTEGGPLNLKAFEMAGYIREAIHQHMAHF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcatagaggatatcagcgaagaggtctggcaagactgcatcactcttttccta
cagacttggatgtgctgtgatgcagccattatcaccaattccccaccctggatgttagct
tcttaccctgaaggcaacttgttccagttgacccaggaagaaattcagatcttgctggca
agagaggggagagagaaatttcttcaagggatcactcttgcagggaccaaatgcttattg
attcgggacaacctttacactgagggaaacaacaccatggacctccgcaccaaaggccag
agtcggtgcagccaggaagtcactgtagttcagattgagtctgtataccttgtgatgatg
ggacaaaaaggaacagaaggagggcctctcaaccttaaggcttttgagatggcaggttac
atcagagaagccattcatcaacacatggcccatttctaa

DBGET integrated database retrieval system