KEGG   Felis catus (domestic cat): 101101566Help
Entry
101101566         CDS       T02385                                 

Gene name
TTK
Definition
(RefSeq) TTK protein kinase
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101101566 (TTK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101101566 (TTK)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: Other group
  TTK family
   101101566 (TTK)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101101566 (TTK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
B2
AA seq 856 aa AA seqDB search
MEAEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKVSADTTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLNDALLNKLIGRYSQAIEALPPDKYGQNESFAQIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNFKKSKQLLHKAVECGAVPLEML
EIAIRNLNLQKKQLLSEEEKKSLSASTILTAQESFPNSLGHLQNRNISCDSRGQTTKAKF
LYGENLPPQDAEIGHRNPLKQTKKAKRSCPFGRVPVNLLSSPDYGKTDDSVVPSFTKSRQ
TSGSERQDMIVPGSKSSGNDSSELRNLKSIQNIHSKEPLMSDEKSSELITDSVTLKNKTE
SSLVSKLEEIKEHQEPKVPESNQKQWQSKRKSECINQNPAVSSNQWQIPDTAQKVDTEQK
QTTFEQPAFSVSKQSPPISAPKWIDPKSVCKTPSSSALDDYMSCFRTPVVKNDFPPACQL
STPYSQLACFQQQQQIPVTPLQTLQISASSSTNECISVKGRIYSILKQIGSGGSSKVFQV
LNEKKQIHAIKYVNLEEADNQTIDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVM
ECGNIDLNSWLKKKKSINPWERKSYWKNMLEAVYTIHQHGIVHSDLKPANFLIVDGMLKL
IDFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGC
ILYYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLIRDPKQRISI
PELLVHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYDRYSSGEGH
DSSSSSKTFEKKWEKK
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaggatttaagtggcagagaattgacaattgattctataatgaacaaagtg
agggatattaaaaataaatttaaaaatgaagaccttactgatgagctaagcttgaataaa
gtctctgccgatactacagataactcgggaactgtcaaccaaattatgatgatggcaaac
aacccggaggactggttgaatttgttgctcaaactagagaaaaacagtgtccctctgaat
gatgctcttttaaataaattaattggtcgttacagtcaagcaattgaagcacttcctcca
gataaatatggccaaaacgagagttttgctcaaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgacgcacgggactactttcagatggccagagcaaactgcaag
aaatttgcttttgtgcatatatcttttgcacaatttgaattatcacaaggtaatttcaaa
aaaagtaaacaacttcttcataaagctgtagaatgtggagcagtaccactggaaatgcta
gaaattgccattcggaatttaaaccttcaaaaaaagcagctgctttcagaggaggaaaag
aagagtttatcagcatctacaatattaactgctcaagaatcattccccaattcacttgga
catttacagaataggaacatcagttgtgattccagaggacagactactaaagccaagttt
ttgtatggagaaaacttgccccctcaagatgcagaaataggtcatcgaaatcccttgaaa
caaacaaagaaagctaaacggtcatgcccttttggaagagtcccagttaaccttctaagt
agcccggattatgggaagacagatgattcagttgtaccaagttttacaaaaagcagacag
acctctggatcagaacgccaagatatgattgtacctggatctaaatcaagtggaaatgat
tccagtgaattgagaaatttaaagtctattcaaaatatccattccaaggaacctctgatg
tcagatgagaagagttctgaacttattacagattcagtaaccttgaagaataaaactgaa
tcaagtcttgtatcaaaattggaagaaattaaggaacatcaagaaccaaaggttccagag
agtaaccagaaacaatggcagtctaagagaaagtcagaatgtataaaccagaatcctgct
gtatcttcaaatcagtggcagattccagacacagcccaaaaagttgatacagagcagaaa
cagaccacttttgaacaacctgccttttcagtttcaaagcagtcaccaccaatatcagca
cctaaatggattgacccaaaatctgtttgtaagacacccagtagcagtgccttggatgat
tacatgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcagttg
tcaacaccttatagccaactcgcctgtttccagcagcagcagcaaatacctgttactcca
cttcaaactttacagatttcagcatcctcttcaacaaatgaatgcatttcagttaaagga
agaatttattccatattgaagcagataggaagtggaggctcaagtaaggtattccaggta
ttgaatgaaaagaaacagatacatgctataaagtatgtgaacctagaagaagcagataat
caaacaatcgatagttatcggaatgaaattgcttatttgaataaactacaacaacacagt
gataagatcatccgactttatgattatgaaatcacggaccagtacatttacatggtaatg
gaatgtggaaatatagatcttaatagttggctcaaaaagaaaaaatccatcaatccatgg
gaacgtaaaagttactggaaaaatatgttggaggcagtttacacaattcatcaacatggc
atcgttcacagtgatctgaaacctgctaactttctgatagttgatggaatgctaaaacta
attgattttgggattgcaaatcaaatgcaaccagatacaacaagtattgttaaagactct
caggttggtacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcaaga
gagaatgggaagtccaagtcaaagataagtcccaaaagtgacgtttggtccttaggatgc
attttgtactatatgacttatgggaagacaccatttcaacatataattaatcagatttct
aaattacatgccataattgaccctaatcatgaaatcgaatttcctgatatcccagagaaa
gatcttcaagatgtgttaaagtgttgtttaataagggaccctaaacagaggatatccatt
cctgagcttctggtgcatccgtatgttcaaattcaaactcatccaggtaatcagatggct
aagggcaccactgaagaaatgaaatatgttctgggccaactcgttggtctgaattctcct
aactccattttgaaagctgctaaaactttatatgaccgatatagtagtggtgaaggtcat
gattcctcttcatcatccaagacttttgaaaaaaaatgggagaaaaaatga

DBGET integrated database retrieval system