KEGG   Felis catus (domestic cat): 101101566Help
Entry
101101566         CDS       T02385                                 

Gene name
TTK
Definition
TTK protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Cell cycle
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:fca04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B2
AA seq 855 aa AA seqDB search
MEAEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKVSADTTDNSGTVNQIMMMAN
NPEDWLNLLLKLEKNSVPLNDALLNKLIGRYSQAIEALPPDKYGQNESFAQIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNFKKSKQLLHKAVECGAVPLEML
EIAIRNLNLQKKQLLSEEEKKSLSASTILTAQESFPNSLGHLQNRNISCDSRGQTTKAKF
LYGENLPPQDAEIGHRNPLKQTKKAKQSCPFGRVPVNLLSSPDYGKTDDSVVPSFTKRQT
SGSERQDMIVPGSKSSGNDSSELRNLKSIQNIHSKEPLMSDEKSSELITDSVTLKNKTES
SLVSKLEEIKEHQEPKVPESNQKQWQSKRKSECINQNPAVSSNQWQIPDTAQKVDTEQKQ
TTFEQPAFSVSKQSPPISAPKWIDPKSVCKTPSSSALDDYMSCFRTPVVKNDFPPACQLS
TPYSQLACFQQQQQIPVTPLQTLQISASSSTNECISVKGRIYSILKQIGSGGSSKVFQVL
NEKKQIHAIKYVNLEEADNQTIDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVME
CGNIDLNSWLKKKKSINPWERKSYWKNMLEAVYTIHQHGIVHSDLKPANFLIVDGMLKLI
DFGIANQMQPDTTSIVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCI
LYYMTYGKTPFQHIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLIRDPKQRISIP
ELLVHPYVQIQTHPGNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYDRYSSGEGHD
SSSSSKTFEKKWEKK
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaggatttaagtggcagagaattgacaattgattctataatgaacaaagtg
agggatattaaaaataaatttaaaaatgaagaccttactgatgagctaagcttgaataaa
gtctctgccgatactacagataactcgggaactgtcaaccaaattatgatgatggcaaac
aacccggaggactggttgaatttgttgctcaaactagagaaaaacagtgtccctctgaat
gatgctcttttaaataaattaattggtcgttacagtcaagcaattgaagcacttcctcca
gataaatatggccaaaacgagagttttgctcaaattcaagtgagatttgctgaattaaaa
gctattcaagagccagatgacgcacgggactactttcagatggccagagcaaactgcaag
aaatttgcttttgtgcatatatcttttgcacaatttgaattatcacaaggtaatttcaaa
aaaagtaaacaacttcttcataaagctgtagaatgtggagcagtaccactggaaatgcta
gaaattgccattcggaatttaaaccttcaaaaaaagcagctgctttcagaggaggaaaag
aagagtttatcagcatctacaatattaactgctcaagaatcattccccaattcacttgga
catttacagaataggaacatcagttgtgattccagaggacagactactaaagccaagttt
ttgtatggagaaaacttgccccctcaagatgcagaaataggtcatcgaaatcccttgaaa
caaacaaagaaagctaaacagtcatgcccttttggaagagtcccagttaaccttctaagt
agcccggattatgggaagacagatgattcagttgtaccaagttttacaaaaagacagacc
tctggatcagaacgccaagatatgattgtacctggatctaaatcaagtggaaatgattcc
agtgaattgagaaatttaaagtctattcaaaatatccattccaaggaacctctgatgtca
gatgagaagagttctgaacttattacagattcagtaaccttgaagaataaaactgaatca
agtcttgtatcaaaattggaagaaattaaggaacatcaagaaccaaaggttccagagagt
aaccagaaacaatggcagtctaagagaaagtcagaatgtataaaccagaatcctgctgta
tcttcaaatcagtggcagattccagacacagcccaaaaagttgatacagagcagaaacag
accacttttgaacaacctgccttttcagtttcaaagcagtcaccaccaatatcagcacct
aaatggattgacccaaaatctgtttgtaagacacccagtagcagtgccttggatgattac
atgagctgttttagaactccagttgtaaagaatgactttccacctgcttgtcagttgtca
acaccttatagccaactcgcctgtttccagcagcagcagcaaatacctgttactccactt
caaactttacagatttcagcatcctcttcaacaaatgaatgcatttcagttaaaggaaga
atttattccatattgaagcagataggaagtggaggctcaagtaaggtattccaggtattg
aatgaaaagaaacagatacatgctataaagtatgtgaacctagaagaagcagataatcaa
acaatcgatagttatcggaatgaaattgcttatttgaataaactacaacaacacagtgat
aagatcatccgactttatgattatgaaatcacggaccagtacatttacatggtaatggaa
tgtggaaatatagatcttaatagttggctcaaaaagaaaaaatccatcaatccatgggaa
cgtaaaagttactggaaaaatatgttggaggcagtttacacaattcatcaacatggcatc
gttcacagtgatctgaaacctgctaactttctgatagttgatggaatgctaaaactaatt
gattttgggattgcaaatcaaatgcaaccagatacaacaagtattgttaaagactctcag
gttggtacagttaattatatgccaccagaagcaatcaaagatatgtcttcctcaagagag
aatgggaagtccaagtcaaagataagtcccaaaagtgacgtttggtccttaggatgcatt
ttgtactatatgacttatgggaagacaccatttcaacatataattaatcagatttctaaa
ttacatgccataattgaccctaatcatgaaatcgaatttcctgatatcccagagaaagat
cttcaagatgtgttaaagtgttgtttaataagggaccctaaacagaggatatccattcct
gagcttctggtgcatccgtatgttcaaattcaaactcatccaggtaatcagatggctaag
ggcaccactgaagaaatgaaatatgttctgggccaactcgttggtctgaattctcctaac
tccattttgaaagctgctaaaactttatatgaccgatatagtagtggtgaaggtcatgat
tcctcttcatcatccaagacttttgaaaaaaaatgggagaaaaaatga

DBGET integrated database retrieval system