KEGG   Felis catus (domestic cat): 102900869Help
Entry
102900869         CDS       T02385                                 

Definition
(RefSeq) lysozyme C, milk isozyme
  KO
K13915  
lysozyme C [EC:3.2.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    102900869
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102900869
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102900869
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B4
AA seq 148 aa AA seqDB search
MRSILIISLLGCFFAAYEAKIFPKCELARKLKAEGMDGFHGYSLANWVCMAEHESNFNTR
AFNGKNDNGSSDYGIFQINSKWWCKNNSSPSANACNTMCSRFLDDNISDDIACAKRVVKD
PNGMSAWVAWVRHCRNKDLSRYLASCNL
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccattctgatcatctccctcctcggctgcttctttgcagcatatgaggccaaa
atcttccccaagtgtgagctggcccgcaagctgaaggcagagggaatggatggcttccac
ggctacagcctggcaaactgggtctgcatggctgagcatgagagtaacttcaacacccgg
gccttcaatgggaaaaatgacaatggcagcagtgactatgggatcttccagatcaacagc
aagtggtggtgcaaaaataactcctccccttcagcaaatgcctgcaacacaatgtgcagt
aggtttctggatgacaacatcagtgatgacatcgcctgtgccaagagggtcgtgaaagat
cctaatgggatgtctgcctgggtggcctgggtaagacactgcagaaacaaggatttgtcc
agatatctagccagttgtaatctgtga

DBGET integrated database retrieval system