KEGG   Felis catus (domestic cat): 445455Help
Entry
445455            CDS       T02385                                 

Gene name
CES5A, CES7
Definition
carboxylesterase 5A (EC:3.1.1.1)
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     445455 (CES5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E2
AA seq 545 aa AA seqDB search
MSGMWVHPGRTLIWALWVLAAVIKGPAADAPVRSTRLGWVRGKQTTVLGSTVPVNMFLGI
PYAAPPLGPLRFKQPKPALPGNDFRNATSYPKLCFQDLEWLVSYQHVLKVRYPKLEASED
CLYLNIYAPAHADNGSNLPVMVWFPGGAFKMGSASSFDGSALAAYEDVLIVTTQYRLGIF
GFFDTGDEHARGNWALLDQVAALTWVRDNIEFFGGDPRSVTIFGESAGAISVSSLILSPI
ANGLFHKAIMESGVAILPLLMRPPGDERKKDLQVLARICGCHASDSAALLQCLRAKPSEE
LMDISKKLTFSIPVIDDFFFPDEPVALLTQKAFNSVPSIIGVNNHECAFLLSTEFSEILG
GSNRSLALYLVHTFLNIPTQYLHLVADHYFYNKHSPVEIRDSFLDLLGDVLFVVPGVVTA
RYHRDAGAPVYFYEFQHPPQCLNDTRPAFVKADHSDEIRFVFGGAFLKGDIVMFEGATEE
EKLLSRKMMRYWANFARTGDPNGEGVPLWPAYTQSEQYLKLDLSVSVGQKLKEQEVEFWM
NTIVP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggatgtgggtgcacccaggccggaccctgatctgggctctttgggtccttgca
gctgtcattaaggggccagctgctgatgcaccagtgaggagcaccaggctgggatgggtc
cgggggaagcaaaccactgtactgggaagcaccgtgcctgtgaacatgttcctcgggatc
ccctatgctgcacctcctctagggcccctgcgatttaagcaaccaaagcctgctctgccc
gggaatgacttccgaaatgccacatcctaccctaaattatgcttccaggacttagagtgg
ctggtctcctatcaacacgttctcaaagtgcgttaccccaaattggaagcgtccgaagac
tgcctgtaccttaacatctatgcgccagcccatgcggacaatggctccaacctccctgtc
atggtgtggttccccgggggtgccttcaagatgggctcagcttcctccttcgatgggtcc
gccttggctgcctacgaggacgtgctgatcgtgactacccagtaccggctaggaatattt
ggttttttcgacacaggggatgagcatgcccgggggaactgggccttgctggaccaggtg
gctgccctaacctgggtccgggacaacatcgagttcttcggtggtgacccacgctccgtg
accatctttggagagtcagcgggagccatcagtgtttccagcctcattctgtcccccata
gccaatggcttattccacaaagccatcatggagagtggggtggccatcctgcctttactg
atgagaccccctggtgatgagaggaagaaggatttgcaggtgcttgcgcgtatctgtggt
tgccatgcgtctgactctgctgccctgctgcagtgcctgagggcaaaaccctccgaggag
ttgatggacatcagcaagaaactcacgttttccattccagtgattgatgactttttcttt
cctgatgagcctgtagccctattgactcaaaaagcatttaattcagttccttctatcatc
ggagtcaataaccacgagtgtgccttccttctgtccacggagttttctgagatcctcggg
ggctccaacaggtctctggccctctacttagtacacacgttcctgaatattcccacccag
tatttgcaccttgtggctgatcattacttctacaacaagcactccccggttgaaatacga
gatagttttctggacttgcttggagatgtgctctttgtggtccctggggtggtcacagct
cgatatcatagagatgctggtgcacctgtctacttctatgagtttcaacacccgccccag
tgcttaaacgacacgaggccagctttcgtgaaagccgatcactctgatgaaatccgcttc
gtctttggaggtgccttcctgaaaggcgacattgtcatgttcgaaggagccaccgaggag
gagaaattgctgagcaggaagatgatgaggtactgggccaactttgctcggaccggggac
cctaacggggaaggtgtgcctctgtggccagcctacacccagagcgagcagtacctgaag
ctggatttgagtgtgagcgtgggacagaaactgaaggagcaagaggtggagttttggatg
aataccattgtcccctga

DBGET integrated database retrieval system