KEGG   Felis catus (domestic cat): 493690Help
Entry
493690            CDS       T02385                                 

Gene name
BDNF
Definition
brain-derived neurotrophic factor
Orthology
K04355  
brain-derived neurotrophic factor
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Neurotrophin signaling pathway
Huntington's disease
Cocaine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    493690 (BDNF)
   04024 cAMP signaling pathway
    493690 (BDNF)
 Organismal Systems
  Nervous system
   04722 Neurotrophin signaling pathway
    493690 (BDNF)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    493690 (BDNF)
  Substance dependence
   05030 Cocaine addiction
    493690 (BDNF)
   05034 Alcoholism
    493690 (BDNF)
Cytokines [BR:fca04052]
 PDGF family
  Cysteine-knot growth factors
   Subclass II
    493690 (BDNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D1
AA seq 247 aa AA seqDB search
MTILFLTMVISYFGCMKAAPMKEANVRGQGSLAYPGVRTHGTLESVNGPKAGSRRLTSLA
DTFEHVIEELLDEDQKGRPNEENSKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAA
NMSVRVRRHSDPARRGELSVCDGISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQY
FYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCT
LTIKRGR
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgccccc
atgaaagaagccaacgtccgaggacaaggcagcttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaacgggcccaaggcagggtcgagacgcctgacatccttggct
gacacttttgaacacgtgatagaagagctgttggacgaggaccagaaaggtcgacccaat
gaagaaaacagtaaggacgcggacttatacacttccagggtgatgctcagtagtcaagtg
cctttggagcctcctctcctctttctgcttgaggaatacaaaaattacctggatgctgca
aacatgtctgtgagggtccggcgccactctgaccctgcccgccgcggggagctgagcgtg
tgcgacggcattagcgagtgggtgacagcggcagataaaaagactgcagtggacatgtcg
ggcgggacggtcaccgtccttgaaaaagtccctgtatcgaaaggccaactgaagcagtac
ttctacgagaccaagtgcaatcccatgggttacacaaaggagggctgcaggggcatagac
aaaaggcattggaactcccagtgccgaactacccagtcgtacgtgcgggccctcaccatg
gatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgtatgtaca
ttgaccattaagaggggaagatag

DBGET integrated database retrieval system