KEGG   Felis catus (domestic cat): 493701Help
Entry
493701            CDS       T02385                                 

Gene name
BCL2L1, bcl-xl
Definition
BCL2-like 1
Orthology
K04570  
BCL2-like 1 (apoptosis regulator Bcl-X)
Organism
fca  Felis catus (domestic cat)
Pathway
Ras signaling pathway
NF-kappa B signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Jak-STAT signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Pancreatic cancer
Chronic myeloid leukemia
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    493701 (BCL2L1)
   04630 Jak-STAT signaling pathway
    493701 (BCL2L1)
   04064 NF-kappa B signaling pathway
    493701 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    493701 (BCL2L1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    493701 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    493701 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    493701 (BCL2L1)
   05212 Pancreatic cancer
    493701 (BCL2L1)
   05220 Chronic myeloid leukemia
    493701 (BCL2L1)
   05222 Small cell lung cancer
    493701 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    493701 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    493701 (BCL2L1)
   05145 Toxoplasmosis
    493701 (BCL2L1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493701 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A3
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcggtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtcaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgctccaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system