KEGG   Felis catus (domestic cat): 493701Help
Entry
493701            CDS       T02385                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01524  Platinum drug resistance
fca04014  Ras signaling pathway
fca04064  NF-kappa B signaling pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04621  NOD-like receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05145  Toxoplasmosis
fca05166  HTLV-I infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    493701 (BCL2L1)
   04630 Jak-STAT signaling pathway
    493701 (BCL2L1)
   04064 NF-kappa B signaling pathway
    493701 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    493701 (BCL2L1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    493701 (BCL2L1)
   04137 Mitophagy - animal
    493701 (BCL2L1)
  Cell growth and death
   04210 Apoptosis
    493701 (BCL2L1)
   04215 Apoptosis - multiple species
    493701 (BCL2L1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    493701 (BCL2L1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    493701 (BCL2L1)
   05202 Transcriptional misregulation in cancers
    493701 (BCL2L1)
   05212 Pancreatic cancer
    493701 (BCL2L1)
   05225 Hepatocellular carcinoma
    493701 (BCL2L1)
   05220 Chronic myeloid leukemia
    493701 (BCL2L1)
   05222 Small cell lung cancer
    493701 (BCL2L1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    493701 (BCL2L1)
  Infectious diseases
   05166 HTLV-I infection
    493701 (BCL2L1)
   05145 Toxoplasmosis
    493701 (BCL2L1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    493701 (BCL2L1)
   01524 Platinum drug resistance
    493701 (BCL2L1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493701 (BCL2L1)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    493701 (BCL2L1)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   493701 (BCL2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Motif
Other DBs
NCBI-GeneID: 493701
NCBI-ProteinID: NP_001009228
Ensembl: ENSFCAG00000025748
UniProt: Q8SQ42
Position
A3
AA seq 233 aa AA seqDB search
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcggtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtcaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgctccaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system