KEGG   Felis catus (domestic cat): 493774Help
Entry
493774            CDS       T02385                                 

Gene name
CES1, CES-K1
Definition
carboxylesterase 1 (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    493774 (CES1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     493774 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E2
AA seq 566 aa AA seqDB search
MWLLALVLTSLTTSMTWAGHPSSPPVVDTSQGKVLGKHVSVEGFAQPVAVFLGIPFARPP
LGSLRFAPPQPAEPWNFVKNTTSYPPMCSQDAAGGQVLSDLFTNRKESIPLTFSEDCLYL
NIYTPVDLRKKNRLPVMVWIHGGGLMVGGASTYSGLVLSAHENVVVVTIQYRLGIWGYFS
TGDEHSRGNWGLLDQVAALRWVQENIANFGGNPGSVTIFGESAGGISVSILVLSPLAKNL
FHRAISESGVALITALVKKDMKDAAQQIAFFAGCKTTTSAVTVHCLRQKTEEELLEISRK
MKFFTIDLYGDSRENHAFLPIVVDGVLLPKMPEEILAEKKFNFVPYIIGINKHEFGWLLP
KLMGYPLSEGKLDQKTAMSLLWKSCPIIGIPEELIPLAAEKYLEGTDDPVKKKDLFLEVL
GDAMFGVPSVTVARYHRDAGAPTYMYEFQYHPSFSSDMKPKTLIGDHGDELYSVFGAPFL
KGGASEEEIRLSKTMMKFWANFARSGNPNGEGLPSWPAYDQKEGYLQIGATTQPAQKLKD
KEVAFWTELLAQGAAKKPPHKEHVEL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcttagctctggtcttgacctccctcaccacttccatgacttgggcagggcac
ccgtcctcacctcctgtggtggacacctctcaaggcaaagtcctgggcaagcacgtcagc
gtagaaggatttgcacagcctgtggccgtcttcctgggaatcccttttgccaggcctcct
cttggatccctgaggtttgctccaccacagcctgcagagccatggaacttcgtgaagaat
accacctcctaccctcctatgtgctcccaggatgcagcgggagggcaggtgctctccgac
ctctttaccaacaggaaggaaagcattcctctcacgttttccgaagactgcctgtaccta
aatatttacactcctgttgacttgaggaagaagaacaggctgccggtgatggtgtggatc
cacggagggggtctgatggtgggtggagcatcaacctatagtggactggtcctctctgcc
catgaaaatgtggtggtggtgaccattcagtaccgcctgggcatctggggatacttcagc
acgggggacgaacacagccggggaaactggggtctgttggaccaggtggccgcacttcgc
tgggtccaggagaacattgccaactttggagggaacccgggttctgtcactatcttcgga
gagtcagcaggaggtatcagcgtctctattcttgtgttatctccactggccaagaacctc
ttccaccgggccatctccgagagtggcgtggccctcattactgccctggtcaagaaagac
atgaaggatgcagctcagcaaattgctttctttgctgggtgtaaaaccaccacctcggct
gtcactgttcactgcctgcgccagaagacagaagaggagctcttggagatatcgcggaaa
atgaaatttttcactattgatttatatggagactccagagagaaccatgccttcctgccc
atcgtggtggatggagtactgttaccaaagatgcctgaagagattctggcagaaaagaaa
ttcaactttgttccctatatcatcggaatcaacaagcatgagtttggttggcttcttcca
aagctgatgggttacccactctctgaaggcaagctggaccagaagacagccatgtcactc
ctgtggaagtcttgcccgattattggcatccctgaggaattgattccactggccgctgag
aagtatttagaagggacagatgaccctgtcaaaaagaaagacctgttcttggaagtactt
ggagatgcgatgtttggtgtcccatctgtgactgtggcccgttaccacagagatgccgga
gcccccacgtacatgtatgagttccagtatcatccaagcttctcatcagacatgaaaccc
aagacgttgataggggaccatggcgatgagctgtactcagtcttcggggcaccattttta
aaaggaggtgcttcagaagaggagatcagactcagcaagacgatgatgaaattttgggcc
aattttgctcggagtgggaaccccaatggggaaggactgccctcttggccggcatatgac
cagaaggaagggtatctgcagattggagccactactcagccggcccagaagctgaaagac
aaggaagtggctttctggaccgagctcctggcccagggggcagcaaaaaagccaccccac
aaagagcacgttgagctgtga

DBGET integrated database retrieval system