KEGG   Felis catus (domestic cat): 493836Help
Entry
493836            CDS       T02385                                 

Gene name
CXCL8, IL8
Definition
interleukin 8
Orthology
K10030  
interleukin 8
Organism
fca  Felis catus (domestic cat)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
Malaria
Amoebiasis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Transcriptional misregulation in cancer
Bladder cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    493836 (CXCL8)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493836 (CXCL8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    493836 (CXCL8)
   04621 NOD-like receptor signaling pathway
    493836 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    493836 (CXCL8)
   04062 Chemokine signaling pathway
    493836 (CXCL8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    493836 (CXCL8)
   05202 Transcriptional misregulation in cancers
    493836 (CXCL8)
   05219 Bladder cancer
    493836 (CXCL8)
  Immune diseases
   05323 Rheumatoid arthritis
    493836 (CXCL8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493836 (CXCL8)
  Infectious diseases
   05132 Salmonella infection
    493836 (CXCL8)
   05133 Pertussis
    493836 (CXCL8)
   05134 Legionellosis
    493836 (CXCL8)
   05164 Influenza A
    493836 (CXCL8)
   05161 Hepatitis B
    493836 (CXCL8)
   05160 Hepatitis C
    493836 (CXCL8)
   05146 Amoebiasis
    493836 (CXCL8)
   05144 Malaria
    493836 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    493836 (CXCL8)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  493836 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B1
AA seq 101 aa AA seqDB search
MTSKLVVALLAAFMLSAALCEAAVLSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt
gaagctgcagttttgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

DBGET integrated database retrieval system