KEGG   Felis catus (domestic cat): 493836Help
Entry
493836            CDS       T02385                                 

Gene name
IL8
Definition
interleukin 8
Orthology
K10030  
interleukin 8
Organism
fca  Felis catus (domestic cat)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
NF-kappa B signaling pathway
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Salmonella infection
Pertussis
Legionellosis
Chagas disease (American trypanosomiasis)
Malaria
Amoebiasis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Transcriptional misregulation in cancer
Bladder cancer
Rheumatoid arthritis
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:fca04064]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:fca04060]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:fca04620]
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:fca04621]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:fca04622]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:fca04062]
Human Diseases; Cancers; Pathways in cancer [PATH:fca05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:fca05202]
Human Diseases; Cancers; Bladder cancer [PATH:fca05219]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:fca05323]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:fca04932]
Human Diseases; Infectious diseases; Salmonella infection [PATH:fca05132]
Human Diseases; Infectious diseases; Pertussis [PATH:fca05133]
Human Diseases; Infectious diseases; Legionellosis [PATH:fca05134]
Human Diseases; Infectious diseases; Influenza A [PATH:fca05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:fca05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:fca05160]
Human Diseases; Infectious diseases; Amoebiasis [PATH:fca05146]
Human Diseases; Infectious diseases; Malaria [PATH:fca05144]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:fca05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B1
AA seq 101 aa AA seqDB search
MTSKLVVALLAAFMLSAALCEAAVLSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt
gaagctgcagttttgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

DBGET integrated database retrieval system