KEGG   Felis catus (domestic cat): 493836Help
Entry
493836            CDS       T02385                                 

Gene name
CXCL8
Definition
(RefSeq) interleukin-8 precursor
  KO
K10030  interleukin 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04072  Phospholipase D signaling pathway
fca04218  Cellular senescence
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05132  Salmonella infection
fca05133  Pertussis
fca05134  Legionellosis
fca05142  Chagas disease (American trypanosomiasis)
fca05144  Malaria
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05164  Influenza A
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05219  Bladder cancer
fca05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    493836 (CXCL8)
   04072 Phospholipase D signaling pathway
    493836 (CXCL8)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493836 (CXCL8)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    493836 (CXCL8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    493836 (CXCL8)
   04621 NOD-like receptor signaling pathway
    493836 (CXCL8)
   04622 RIG-I-like receptor signaling pathway
    493836 (CXCL8)
   04657 IL-17 signaling pathway
    493836 (CXCL8)
   04062 Chemokine signaling pathway
    493836 (CXCL8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    493836 (CXCL8)
   05202 Transcriptional misregulation in cancers
    493836 (CXCL8)
   05219 Bladder cancer
    493836 (CXCL8)
  Immune diseases
   05323 Rheumatoid arthritis
    493836 (CXCL8)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    493836 (CXCL8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    493836 (CXCL8)
  Infectious diseases
   05132 Salmonella infection
    493836 (CXCL8)
   05133 Pertussis
    493836 (CXCL8)
   05134 Legionellosis
    493836 (CXCL8)
   05164 Influenza A
    493836 (CXCL8)
   05161 Hepatitis B
    493836 (CXCL8)
   05160 Hepatitis C
    493836 (CXCL8)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    493836 (CXCL8)
   05146 Amoebiasis
    493836 (CXCL8)
   05144 Malaria
    493836 (CXCL8)
   05142 Chagas disease (American trypanosomiasis)
    493836 (CXCL8)
Cytokines [BR:fca04052]
 Chemokines
  CXC chemokine family
   493836 (CXCL8)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
   493836 (CXCL8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 493836
NCBI-ProteinID: NP_001009281
Ensembl: ENSFCAG00000004666
UniProt: Q9XSX5
Position
B1
AA seq 101 aa AA seqDB search
MTSKLVVALLAAFMLSAALCEAAVLSRISSELRCQCIKTHSTPFNPKLIKELTVIDSGPH
CENSEIIVKLVNGKEVCLDPKQKWVQKVVEIFLKKAEKQNA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgacttccaagctggttgttgctctcttagcagctttcatgctttctgcagctctgtgt
gaagctgcagttttgtcaagaattagttcagaacttcgatgccagtgcataaaaactcat
tccacacctttcaatcccaaattaatcaaagaactgacagtgattgacagtggcccacac
tgtgaaaactcagaaatcattgtaaagctcgtcaatggaaaagaggtgtgcctggacccc
aagcaaaagtgggtgcagaaggttgtggagatatttttgaagaaagctgagaaacaaaat
gcataa

DBGET integrated database retrieval system