KEGG   Felis catus (domestic cat): 493928Help
Entry
493928            CDS       T02385                                 

Gene name
HEXB
Definition
hexosaminidase B (beta polypeptide) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fca00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:fca00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:fca00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:fca00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fca00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 499 aa AA seqDB search
MPLSVKTSPRLLHLSRDNFSIGYGPSSTAGPTCSLLQEAFRRYHEYIFGFDKRQRRPAKP
NSAIELQQLLVTVVLDSECDLFPNITSDESYTLLVKEPVAFLKANRVWGVLRGLETFSQL
IYQDSYGTFTVNESDIIDSPRFPHRGILIDTARHFLPVKSILKTLDAMAFNKFNVLHWHI
VDDQSFPYQSVTFPELSNKGSYSLSHVYTPNDVHTVIEYARLRGIRVIPEFDSPGHTQSW
GKGQKDLLTPCYNEHKQSGTFGPINPILNSTYNFLSQFFKEVSMVFPDHFVHLGGDEVEF
QCWESNPEIQGFMKQKGFGKDFRRLESFYLQKLLGIVSTVKKGSIVWQEVFDDHVKLLPG
TIVQVWKNQVYTEELREVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLHFDGSQEQK
KLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPEDITSVGNAYNRLTVHRCRMVR
RGISAEPLFTGYCDYEYKT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctcggtgaagacgtctccgcgcctgctgcacctctcccgcgacaacttctcc
atcggctacggcccctcgtccaccgccggccccacctgctccctcctgcaggaagctttt
cggcgatatcacgaatacatttttggtttcgacaagaggcagcgtcgccctgctaaacct
aatagtgcgatagagttacagcaacttctcgtcacggttgtcctggactcggagtgtgat
cttttccccaacatcacttcagacgagtcctatactttacttgtgaaagaaccagtggct
ttcctcaaggccaacagagtttggggagtattacgaggtttagagacctttagccagtta
atttatcaagattcttacgggactttcaccgtcaatgaatctgacattattgactctcca
aggtttccacatagaggaattttaattgatacagccagacactttctgccagttaagagc
attctcaaaactctggatgccatggcttttaataaatttaatgttctccactggcacata
gttgatgaccagtctttcccttatcagagtgtcacttttcctgagttaagcaacaaaggc
agctattctctgtctcatgtttatacaccaaacgatgtccatacggtgattgaatatgcc
agattacgagggattcgagtcataccagaatttgatagccctggacatacacagtcttgg
ggaaaaggtcagaaagacctcctgactccatgttacaatgaacataagcagtctgggacc
tttggacctataaaccctattctgaattcaacttataacttcctgtctcagtttttcaaa
gaagttagtatggtgtttccagatcactttgttcacttgggaggagatgaagtggaattt
caatgttgggagtctaatccagaaatccagggtttcatgaagcagaaaggttttggcaaa
gattttagaagactagaatctttctaccttcaaaagcttttgggtattgtttcaactgta
aagaagggatccatagtctggcaagaggtttttgatgatcacgtgaagcttctgccaggt
acaattgttcaagtgtggaaaaatcaagtatatactgaggaactacgtgaagtcacagca
gctggcttccctgtgatcctttctgctccttggtacttagattggattagttatggacaa
gactggagaaattactataaagtggaccctcttcattttgatggttctcaagaacagaaa
aaacttgtcattggtggagaagcttgtctgtggggagaatttgtggatgcaactaacctt
actccaagattatggcctcgggcaagtgccgttggtgaaagactctggagtccagaagac
atcacgagtgtagggaatgcctacaacagactgacagttcaccgctgcagaatggtcaga
cggggaatatctgcagaacctctttttactggatattgtgactatgaatacaaaacataa

DBGET integrated database retrieval system