KEGG   Felis catus (domestic cat): 493928Help
Entry
493928            CDS       T02385                                 

Gene name
HEXB
Definition
hexosaminidase B (beta polypeptide) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    493928 (HEXB)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    493928 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo series
    493928 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    493928 (HEXB)
   00511 Other glycan degradation
    493928 (HEXB)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    493928 (HEXB)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     493928 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 499 aa AA seqDB search
MPLSVKTSPRLLHLSRDNFSIGYGPSSTAGPTCSLLQEAFRRYHEYIFGFDKRQRRPAKP
NSAIELQQLLVTVVLDSECDLFPNITSDESYTLLVKEPVAFLKANRVWGVLRGLETFSQL
IYQDSYGTFTVNESDIIDSPRFPHRGILIDTARHFLPVKSILKTLDAMAFNKFNVLHWHI
VDDQSFPYQSVTFPELSNKGSYSLSHVYTPNDVHTVIEYARLRGIRVIPEFDSPGHTQSW
GKGQKDLLTPCYNEHKQSGTFGPINPILNSTYNFLSQFFKEVSMVFPDHFVHLGGDEVEF
QCWESNPEIQGFMKQKGFGKDFRRLESFYLQKLLGIVSTVKKGSIVWQEVFDDHVKLLPG
TIVQVWKNQVYTEELREVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLHFDGSQEQK
KLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPEDITSVGNAYNRLTVHRCRMVR
RGISAEPLFTGYCDYEYKT
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctcggtgaagacgtctccgcgcctgctgcacctctcccgcgacaacttctcc
atcggctacggcccctcgtccaccgccggccccacctgctccctcctgcaggaagctttt
cggcgatatcacgaatacatttttggtttcgacaagaggcagcgtcgccctgctaaacct
aatagtgcgatagagttacagcaacttctcgtcacggttgtcctggactcggagtgtgat
cttttccccaacatcacttcagacgagtcctatactttacttgtgaaagaaccagtggct
ttcctcaaggccaacagagtttggggagtattacgaggtttagagacctttagccagtta
atttatcaagattcttacgggactttcaccgtcaatgaatctgacattattgactctcca
aggtttccacatagaggaattttaattgatacagccagacactttctgccagttaagagc
attctcaaaactctggatgccatggcttttaataaatttaatgttctccactggcacata
gttgatgaccagtctttcccttatcagagtgtcacttttcctgagttaagcaacaaaggc
agctattctctgtctcatgtttatacaccaaacgatgtccatacggtgattgaatatgcc
agattacgagggattcgagtcataccagaatttgatagccctggacatacacagtcttgg
ggaaaaggtcagaaagacctcctgactccatgttacaatgaacataagcagtctgggacc
tttggacctataaaccctattctgaattcaacttataacttcctgtctcagtttttcaaa
gaagttagtatggtgtttccagatcactttgttcacttgggaggagatgaagtggaattt
caatgttgggagtctaatccagaaatccagggtttcatgaagcagaaaggttttggcaaa
gattttagaagactagaatctttctaccttcaaaagcttttgggtattgtttcaactgta
aagaagggatccatagtctggcaagaggtttttgatgatcacgtgaagcttctgccaggt
acaattgttcaagtgtggaaaaatcaagtatatactgaggaactacgtgaagtcacagca
gctggcttccctgtgatcctttctgctccttggtacttagattggattagttatggacaa
gactggagaaattactataaagtggaccctcttcattttgatggttctcaagaacagaaa
aaacttgtcattggtggagaagcttgtctgtggggagaatttgtggatgcaactaacctt
actccaagattatggcctcgggcaagtgccgttggtgaaagactctggagtccagaagac
atcacgagtgtagggaatgcctacaacagactgacagttcaccgctgcagaatggtcaga
cggggaatatctgcagaacctctttttactggatattgtgactatgaatacaaaacataa

DBGET integrated database retrieval system