KEGG   Felis catus (domestic cat): 493955Help
Entry
493955            CDS       T02385                                 

Gene name
UGT1A1
Definition
UDP glucuronosyltransferase 1 family, polypeptide A1 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    493955 (UGT1A1)
   00053 Ascorbate and aldarate metabolism
    493955 (UGT1A1)
   00500 Starch and sucrose metabolism
    493955 (UGT1A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    493955 (UGT1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    493955 (UGT1A1)
   00860 Porphyrin and chlorophyll metabolism
    493955 (UGT1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    493955 (UGT1A1)
   00982 Drug metabolism - cytochrome P450
    493955 (UGT1A1)
   00983 Drug metabolism - other enzymes
    493955 (UGT1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    493955 (UGT1A1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     493955 (UGT1A1)
Glycosyltransferases [BR:fca01003]
 Others
  Hydrophobic molecule
   493955 (UGT1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 533 aa AA seqDB search
MAARSRGPRPLVLSLLLCALNPLLSQGGKLLLVPMDGSHWLSLFGVIQRLHQRGHDVVVV
APEASVYIKEGAFYTLKSYPVPFRREDVEASFTGLGLGVFEKKPFLQRVVATYKRVKKDS
ALLLSACSHLLYNEELMASLAESGFDAMLTDPFLPCGPIVALRLALPVVFFLNSLPCGLD
FQGTRCPSPPSYVPRVLSLNSDHMTFLQRVKNMLILGSEGFLCNVVYSPYASLASEVLQK
DVTVQDLMGSASVWLFRSDFVKDYSRPIMPNMVFIGGINCAGKNPLSQEFEAYVNASGEH
GIVVFSLGSMVSAIPKEKAMEIADALGKIPQTVLWRYTGTPPPNLAKNTILVKWLPQNDL
LGHPKARAFITHSGSHGIYEGICNGVPMVMLPLFGDQMDNAKRMETRGAGLTLNVLEMTS
EDLANGLKAVINDKSYKENIMRLSSLHKDRPIEPLDLAVFWVEFVMRHKGAPHLRPAAHD
LTWYQYHSVDVIGFLLAIVLGIVFITYKCCAFGCRKCFGRKGRVKKSHKSKTH
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaggtcccgggggccacgtccgcttgtgctgagcctgctgctgtgtgccctg
aatccccttctgtcccagggcgggaagctgttgttggtcccaatggatggcagccactgg
ctgagcttgttcggggtcatccagcggctgcaccagcggggacacgacgtagtggtcgta
gctcctgaggcctccgtgtacattaaagaaggagcgttttacaccttgaagagctacccc
gtcccattccggagggaggacgtggaagcgtcttttactggtctcgggctcggggttttt
gagaagaagcctttcctgcagcgtgtggtcgcgacgtacaagagggtcaagaaggactct
gctctgcttttgtctgcctgctcccacttactgtacaacgaggagctgatggcctccctg
gcggaaagcggcttcgatgccatgttgacagaccctttccttccttgtggccccatcgtg
gccctgcgcctggcgctgcctgtcgtgttcttcttgaactcgctgccctgcggcctagat
tttcaaggtacccgctgccccagcccaccatcctatgtgcccagggttctgtcccttaac
tcagatcacatgactttcctacagcgggtgaagaacatgctcattcttgggtcagagggc
ttcctgtgcaatgtggtttattccccatatgcgtcacttgcttcggaagtccttcagaaa
gatgtgactgtccaggaccttatgggctccgcatcggtctggcttttcagaagtgacttt
gtaaaggattactccaggcccatcatgcccaacatggtttttatcggtgggatcaactgt
gccggcaaaaacccactgtcccaggaatttgaagcctatgttaatgcttctggagaacat
ggaattgtggttttctctttgggctccatggtctcagcgattcccaaggagaaagctatg
gaaattgctgatgctttgggcaaaatacctcagacagtcctgtggcggtatactggcact
ccaccaccaaatcttgcgaagaacacaatacttgtcaagtggcttccccaaaatgatctg
cttggtcacccgaaggctcgtgccttcatcacacattctggctcccatggcatatacgag
gggatatgcaatggcgttcccatggtgatgctgcccttatttggtgatcagatggacaac
gcgaagcgcatggagacccggggggctggattgaccttgaacgtcctggaaatgacttct
gaagatttagcaaatggcctaaaagctgtcatcaatgacaaaagctacaaggagaacatc
atgcgcctgtccagcctgcacaaggaccgccccatcgagcccctggacctggctgtgttc
tgggtagagttcgtgatgaggcacaagggggccccgcacctgcgccctgcagcccacgat
ctcacctggtaccaataccactctgtggacgtgatcggcttcctcctggccattgtgctg
ggcattgtcttcatcacgtacaaatgctgcgccttcggctgccggaagtgctttgggaga
aaaggacgagttaagaaatctcacaagtctaagacacactga

DBGET integrated database retrieval system