KEGG   Felis catus (domestic cat): 727689Help
Entry
727689            CDS       T02385                                 

Gene name
ALPL
Definition
alkaline phosphatase, liver/bone/kidney (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    727689 (ALPL)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     727689 (ALPL)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   727689 (ALPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 524 aa AA seqDB search
MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQQTLKNALRLQKLNTNVVKNVIMFLGD
GMGVSTVTAARILKGQLHHNPGEETRLEMDKFPYVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATQRTQCNTTQGNEVTSILRWAKDSGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMPPEALSQGCKDIAYQLMHNVRDIEVIMGGGRKYMFPKNRTDVEYEMDE
KARGTRLDGLNLVDIWKSFKPRHKHSHYVWNRTELLTLDPYGVDYLLGLFEPGDMQYELN
RNSTTDPSLSEMVEIAIKILSKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDQAIG
RAGAMTSVEDTLTIVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTSILYGNGPG
YKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYAACIGANLDHCASASSAGGPSPGPLFLLLALPSLGILF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatttctccattcttggtgctggccattggcacctgccttaccaactccttagtgcca
gagaaagagaaagaccccaagtactggagggaccaagctcaacagaccctgaaaaatgcc
ctaaggcttcagaagctcaacaccaacgtggttaagaatgtcatcatgttcctgggagat
gggatgggtgtttccacggtgacggccgcccgcatcctcaagggtcagctccaccacaat
cccggggaggagaccaggctggagatggacaagttcccttacgtggccctctccaagaca
tacaacaccaacgctcaggtcccggacagtgcaggcaccgccaccgcctacttatgtggg
gtcaaggccaatgagggcaccgtgggggtgagcgcagccacccagcgaacccagtgcaac
acaactcaggggaacgaagtcacctccatcctgcgctgggccaaggactctggcaaatct
gtgggcattgtgaccaccacgagagtgaaccacgccacccccagtgccgcctacgcccac
tctgctgaccgcgactggtactcagacaacgagatgcccccggaggccctgagtcagggc
tgcaaggacatcgcctaccagctcatgcacaacgtcagggacatcgaggtgatcatgggg
ggtggccggaagtacatgttccccaagaatagaaccgatgtggagtatgagatggacgag
aaggccaggggcacgaggctggacggcctgaacctcgttgacatctggaaaagcttcaaa
ccgagacacaagcactcccactatgtctggaaccgcaccgaactcctgacccttgacccc
tacggggtggactacctcttgggtctctttgagccgggggacatgcagtacgagctgaat
aggaacagcacgactgacccgtcactctctgagatggtggagattgccatcaagatcctg
agcaagaaccccaaaggcttcttcttgctggtggaaggaggcaggattgaccacgggcat
catgaaggcaaggccaagcaggcgctgcatgaggcagtagaaatggaccaggcgatcgga
cgggcaggcgccatgacgtccgtggaagacacactgaccatcgtcactgcagaccactcc
catgtcttcactttcggcgggtataccccccgtggcaactctatctttggtctggccccc
atggtgagtgacacagataagaagcccttcacctccatcctgtatggcaatgggcctggc
tacaaggtagtaggtggtgagcgagagaatgtctccatggtggactacgctcacaacaac
taccaggcgcagtctgctgtgcccctgcgccatgagacccacggtggggaggacgtggcg
gtcttcgccaagggtcccatggcgcacctgctacatggcgtccacgagcagaactacatt
ccccacgtgatggcttacgcggcctgcatcggtgccaaccttgaccactgtgcctcggcc
agctcggcaggtggcccttcaccaggtcccctgttcctcctgctggccctgccctccttg
ggcatcctgttctga

DBGET integrated database retrieval system