KEGG   Felis catus (domestic cat): 727696Help
Entry
727696            CDS       T02385                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase precursor
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00561  Glycerolipid metabolism
fca01100  Metabolic pathways
fca03320  PPAR signaling pathway
fca04979  Cholesterol metabolism
fca05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    727696 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    727696 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    727696 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    727696 (LPL)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     727696 (LPL)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   727696 (LPL)
  Exosomal proteins of breast milk
   727696 (LPL)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   727696 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Enzymes
  727696 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_1 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 727696
NCBI-ProteinID: NP_001036032
Ensembl: ENSFCAG00000012161
UniProt: P55031
Position
B1
AA seq 478 aa AA seqDB search
MESKTLFLMALGIWLQSLTTTRGWVAADDRITGGRDFIDIESKFALRTPEDIAEDTCHLI
PGVTESVANCHFNHTSKTFVVIHGWTVTGMYESWVPKLVAAPYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQVFEISLYGTVAESENIPFTLPEISANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFTIEKIRVKAGETQKKVIFCSREKVSHLQKGKASVVFVKCHDKSLNKKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaaaccctgttcctgatggctctgggcatatggctccagagtctgaccacc
acccgtggatgggtggctgccgacgacagaattacaggaggaagagattttatagatatc
gaaagtaaatttgctctaaggacccctgaagacatagctgaagatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacaccagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccccgtacaagagggaaccagattccaatgtcattgtggtggactggctgtcacgggcc
cagcagcattatccggtgtctgcgggatacaccaagctggtgggaaaggatgtggccaag
tttatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttgggg
tacagccttggagcccatgctgctggaattgcaggaagtctgaccaataagaaggtcaat
agaattactggactagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcctgatgatgcagattttgtagatgtcttacacacattcaccagagggtcacct
ggccgaagtattggaatccagaaaccagtaggacatgttgatatttatcctaatggaggc
acttttcaaccaggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgat
tctctgttgaatgaagaaaaccctagtaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctttgcctgagttgtagaaaaaaccgttgcaacaatttgggttatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcggtctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctgggactgagagtgatacacag
accaaccaggtctttgagatttctctgtatggcactgtggctgagagtgagaacattcct
ttcaccctgcctgaaatttctgcgaataagacatactcctttctaatttacacggaggtg
gatattggggaactgctaatgttgaaactcaaatggaagagcgattcatacttcagctgg
tcagactggtggagcagccctgggtttactattgagaagatcagagtaaaagcaggagag
actcaaaaaaaggtaatcttctgttccagggagaaagtatctcatctgcagaaaggaaag
gcatctgtggtatttgtgaaatgccatgacaagtccctgaataaaaagtctggctga

DBGET integrated database retrieval system