KEGG   Felis catus (domestic cat): 727696Help
Entry
727696            CDS       T02385                                 

Gene name
LPL
Definition
lipoprotein lipase (EC:3.1.1.34)
Orthology
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    727696 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    727696 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    727696 (LPL)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     727696 (LPL)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   727696 (LPL)
  Exosomal proteins of breast milk
   727696 (LPL)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Enzymes (General comment) Variety
  727696 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B1
AA seq 478 aa AA seqDB search
MESKTLFLMALGIWLQSLTTTRGWVAADDRITGGRDFIDIESKFALRTPEDIAEDTCHLI
PGVTESVANCHFNHTSKTFVVIHGWTVTGMYESWVPKLVAAPYKREPDSNVIVVDWLSRA
QQHYPVSAGYTKLVGKDVAKFINWMAEEFHYPLDNVHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQVFEISLYGTVAESENIPFTLPEISANKTYSFLIYTEVDIGELLMLKLKWKSDSYFSW
SDWWSSPGFTIEKIRVKAGETQKKVIFCSREKVSHLQKGKASVVFVKCHDKSLNKKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaaaccctgttcctgatggctctgggcatatggctccagagtctgaccacc
acccgtggatgggtggctgccgacgacagaattacaggaggaagagattttatagatatc
gaaagtaaatttgctctaaggacccctgaagacatagctgaagatacttgccacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacaccagcaaaacctttgtg
gtgatccatggctggacggtgacaggaatgtatgagagttgggtgccaaaacttgtggct
gccccgtacaagagggaaccagattccaatgtcattgtggtggactggctgtcacgggcc
cagcagcattatccggtgtctgcgggatacaccaagctggtgggaaaggatgtggccaag
tttatcaactggatggcggaggaatttcactatcctctggacaatgtccatctcttgggg
tacagccttggagcccatgctgctggaattgcaggaagtctgaccaataagaaggtcaat
agaattactggactagatccagctggacctaactttgaatatgcagaagctccaagtcgc
ctttctcctgatgatgcagattttgtagatgtcttacacacattcaccagagggtcacct
ggccgaagtattggaatccagaaaccagtaggacatgttgatatttatcctaatggaggc
acttttcaaccaggatgtaacattggggaagctatccgtgtgattgcagagagaggcctt
ggagatgtggaccagctagtgaagtgttcccatgagcgctccattcatctctttattgat
tctctgttgaatgaagaaaaccctagtaaggcctaccggtgcaattcaaaggaagccttt
gagaaagggctttgcctgagttgtagaaaaaaccgttgcaacaatttgggttatgagatc
aataaggtcagagccaaaagaagcagcaaaatgtacctgaagactcggtctcagatgcct
tacaaagtcttccattaccaagtaaagatacatttttctgggactgagagtgatacacag
accaaccaggtctttgagatttctctgtatggcactgtggctgagagtgagaacattcct
ttcaccctgcctgaaatttctgcgaataagacatactcctttctaatttacacggaggtg
gatattggggaactgctaatgttgaaactcaaatggaagagcgattcatacttcagctgg
tcagactggtggagcagccctgggtttactattgagaagatcagagtaaaagcaggagag
actcaaaaaaaggtaatcttctgttccagggagaaagtatctcatctgcagaaaggaaag
gcatctgtggtatttgtgaaatgccatgacaagtccctgaataaaaagtctggctga

DBGET integrated database retrieval system