KEGG   Felis catus (domestic cat): 751114Help
Entry
751114            CDS       T02385                                 

Gene name
IL2
Definition
interleukin 2
Orthology
K05429  
interleukin 2
Organism
fca  Felis catus (domestic cat)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Graft-versus-host disease
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:fca04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:fca04060]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:fca04660]
Organismal Systems; Immune system; Intestinal immune network for IgA production [PATH:fca04672]
Human Diseases; Immune diseases; Autoimmune thyroid disease [PATH:fca05320]
Human Diseases; Immune diseases; Inflammatiory bowel disease (IBD) [PATH:fca05321]
Human Diseases; Immune diseases; Allograft rejection [PATH:fca05330]
Human Diseases; Immune diseases; Graft-versus-host disease [PATH:fca05332]
Human Diseases; Endocrine and metabolic diseases; Type I diabetes mellitus [PATH:fca04940]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:fca05166]
Human Diseases; Infectious diseases; Measles [PATH:fca05162]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:fca05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B1
AA seq 154 aa AA seqDB search
MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML
TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS
ETRFTCNYDDETATIVEFLNKWITFCQSIFSTLT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt
gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat
ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc
acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta
gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg
aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct
gaaacaagattcacatgtaactatgatgatgagacagcaaccattgtagaatttctgaac
aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system