KEGG   Felis catus (domestic cat): 751114Help
Entry
751114            CDS       T02385                                 

Gene name
IL2
Definition
interleukin 2
Orthology
K05429  
interleukin 2
Organism
fca  Felis catus (domestic cat)
Pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
Intestinal immune network for IgA production
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
Measles
HTLV-I infection
Autoimmune thyroid disease
Inflammatory bowel disease (IBD)
Allograft rejection
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    751114 (IL2)
   04151 PI3K-Akt signaling pathway
    751114 (IL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    751114 (IL2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    751114 (IL2)
   04672 Intestinal immune network for IgA production
    751114 (IL2)
 Human Diseases
  Immune diseases
   05320 Autoimmune thyroid disease
    751114 (IL2)
   05321 Inflammatiory bowel disease (IBD)
    751114 (IL2)
   05330 Allograft rejection
    751114 (IL2)
   05332 Graft-versus-host disease
    751114 (IL2)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    751114 (IL2)
  Infectious diseases
   05166 HTLV-I infection
    751114 (IL2)
   05162 Measles
    751114 (IL2)
   05142 Chagas disease (American trypanosomiasis)
    751114 (IL2)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Cytokines (General comment) Chemotaxis, singal transduction, inflammation
  751114 (IL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B1
AA seq 154 aa AA seqDB search
MYKIQLLSCIALTLILVTNSAPASSSTKETQQQLEQLLLDLRLLLNGVNNPENPKLSRML
TFKFYVPKKATELTHLQCLVEELKPLEEVLYLAQSKNFHLNHIKELMSNINVTVLKLKGS
ETRFTCNYDDETATIVEFLNKWITFCQSIFSTLT
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaaattcaactcttgtcttgcattgcactgactcttatactcgtcacaaacagt
gcacctgcttcaagctctacaaaggaaacacagcaacagctggagcaattactgctggat
ttacggttgcttttgaatggagttaataatcctgagaaccccaaactctccaggatgctc
acatttaaattttacgtgcccaagaaggccacagaattgacacatcttcagtgtctagta
gaagaactcaaacctctggaggaagtgctatatttagctcaaagcaaaaactttcacttg
aatcacatcaaggaattaatgagcaatatcaatgtaacagttctgaaactaaagggatct
gaaacaagattcacatgtaactatgatgatgagacagcaaccattgtagaatttctgaac
aaatggattaccttttgtcaaagcatcttctcaacgctgacttga

DBGET integrated database retrieval system