KEGG   Felis catus (domestic cat): 780943Help
Entry
780943            CDS       T02385                                 

Gene name
EPAD
Definition
egg and embryo abundant-peptidyl arginine deiminase-like protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     780943 (EPAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 691 aa AA seqDB search
MSFQSLVHLSLDGPIHALCVLGVDICLDLSGCAPEKCKSFTISGSPGVLVDIHNTSPLMT
KEEMATTRWPLSDPMDVLVNMVSPSSAPDGDKVLVSYYLPDEEVPVATAVLCLTGIVVSL
DVDIYRSGQVEVASDKQAKKNWVWGPSGWGAILLVNCSPTDKGQSMDKKTTKVFFPEEIK
SLSQMTLNVQGPSCTLKKYRLVLHTSKEEAEKARVYRPQKDSSSTFEVLLGPGQHTYTFA
PLENHLKETFYVEAVEFPSADFSGLISYSVSLVQESPDPSIPETLVYRDTVVFRVAPCVF
VPSTQMPLEVYLCRELQVQGFVNTVMELSEKSNSQVASVYEDPNRLGRWLQDEMAFCYTQ
APHKTLSFVLDTPRALTLEDFPMKYSLSPGVGYVIQCTQDHRVASMDSIGNLMVSPPVKV
GGKEYPLGRVLIGSCFYPSKEGRDMSKALRDFLYAQRVQAPVELFSDWLMVGHIDEFMCF
IPTQDKSEGEKGFRLLLASPSACYRLFEEKQREGYGDVTLFEEVREDQLLSNGREANTIH
QLLADENMRKQNEYVEKCINLNRDIVKKELGLAERDIIDIPQLFCLEQLTNVPSDQQTGK
FFARPYFPDLLQMMVMGKNLGIPKPFGPQIKGTCCLEKKVCQLLEPLGFKCTFIDDFDCY
LTEVGDFCACANIRRVPFAFKWWRMVPEPQA
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtccttccagagcctcgtccacctgtccctggacggccccatccatgccctctgcgtg
ctgggcgtggacatctgcttggatctcagtgggtgtgccccggagaaatgcaagtcattt
accatcagtggctctccgggggtcttggttgacatccacaacacgtccccgttaatgacc
aaggaggagatggccacgacccggtggcctctgtctgatcccatggatgtcctggtgaat
atggtctcccccagctctgcccccgatggtgacaaggttctggtctcctactatctgcct
gatgaggaagtcccagtggccacggctgtgctctgcctcactggcattgtggtctcccta
gacgtggacatctaccgcagcgggcaagtcgaggtggccagtgacaagcaggctaagaaa
aactgggtctggggacccagcggctggggcgccatcctgcttgtgaactgcagccctacc
gacaagggccagagcatggacaagaagaccacgaaggtgttctttcccgaggagatcaag
agtctgtcccagatgaccctgaatgttcaagggcccagctgcactttaaagaaataccgg
ctggttctccacacctccaaggaagaggcagagaaggcaagagtctaccggccccaaaaa
gacagctcgagcacctttgaggtactgctggggcctggccagcacacctacacctttgcc
cccctcgagaaccacctgaaggaaaccttctacgtggaagctgtggaattcccgtctgcc
gacttctcgggcctgatttcctactctgtctccctggtgcaagaatctccggacccgtcc
attccagagaccctggtatacagagacaccgtggtattccgggtggccccttgcgtcttc
gttcccagcacgcagatgcctctagaggtttacctgtgcagagagctgcaggtccaaggt
tttgtgaacacagtgatggagctgagtgagaagagtaacagccaagtggcatctgtctac
gaggaccccaatcgcctgggcaggtggctccaggacgagatggccttctgttacacccag
gctccccacaagacgctctcctttgtcctcgacacccctcgggccctcacgctggaagat
ttccccatgaaatactcactgagcccaggggtcggttacgtgatccagtgcacccaggac
cacagggtggccagcatggattccattgggaacctgatggtgtccccaccggtcaaggtg
ggagggaaagagtaccccctaggcagggtcctcattggcagctgcttttaccccagcaag
gagggccgagacatgagtaaggccctccgggacttcctctacgcgcagcgagtccaggcc
ccggtggagctcttctcggattggctgatggtcggccacatagacgagttcatgtgcttt
atccccacacaggacaagagtgagggcgaaaagggcttccggctgctcctggccagcccc
agcgcctgctacaggctgtttgaggagaaacagagagagggctatggagacgtgactctg
tttgaggaggtcagagaggatcagctcctctccaacgggagggaggccaataccatccat
caacttctagctgatgaaaacatgagaaagcagaacgaatatgtggagaagtgcattaac
ctgaaccgtgacatcgtgaagaaggagctgggcctggccgagagggacatcatcgacatc
ccacagctcttctgcctggagcagctgacgaacgtcccctccgaccagcagacggggaag
ttcttcgcgaggccgtacttccctgacctgctgcagatgatggtgatgggcaaaaatctg
ggcatccccaagccttttgggccccagatcaagggtacctgctgcctggaaaaaaaggtc
tgccagttgctagagcccctgggcttcaagtgcaccttcattgatgactttgactgctac
ctgactgaagtcggggacttctgtgcctgtgccaacatccgccgggtgccctttgccttc
aaatggtggaggatggtaccggagccccaggcctag

DBGET integrated database retrieval system